Property Summary

NCBI Gene PubMed Count 22
Grant Count 7
Funding $827,216
PubMed Score 129.30
PubTator Score 50.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Synonym

Accession Q13641 A8K555
Symbols 5T4
M6P1
5T4AG
WAIF1

Gene

PANTHER Protein Class (1)

PDB

4CNC   4CNM  

Gene RIF (11)

PMID Text
25738465 In conclusion, the present study provided evidence that TPBG is involved in PDAC metastasis, and that TPBG and its associated signaling pathways may be a suitable target for pancreatic ductal adenocarcinoma therapy.
25066861 5T4 expression is mechanistically associated with the directional movement of cells through epithelial mesenchymal transition, facilitation of CXCL12/CXCR4 chemotaxis, blocking of canonical Wnt/beta-catenin while favouring non-canonical pathway signalling
24582434 Tyrosine 325 plus the leucine-rich repeat 1 surface centered on a second exposed aromatic residue, phenylalanine 97, are essential for inhibition of Wnt/beta-catenin signaling.
22956548 The surface expression of 5T4 marks the use of the CXCR4 rather than the CXCR7 receptor, with distinct consequences for CXCL12 exposure.
22498111 5T4 is a potential new antigen for targeted therapies such as immunotherapy in MPM, as it is overexpressed on mesothelioma cells and recognised by 5T4-specific cytotoxic T-cells.
18833005 colorectal cancer patients who had preexisting cell proliferative responses to 5T4 were longer-term survivors
18567615 5T4-based cancer vaccine: cytotoxic T lymphocyte epitopes identified in Trovax-vaccinated colorectal cancer patients
17978129 the mRNA expression of trophoblast glycoprotein is up-regulated in cells circulating within blood from women with preeclampsia.
16646078 there is a repertoire of CD8 T cell recognition of 5T4 in normal human donors and some candidate HLA-A*0201 epitopes have been identified
16616918 Results sugest that 5T4 is a transient marker of human embryonic stem cell differentiation & that 5T4 phenotype, colony seeding density and culture conditions influence the maintenance of pluripotent hES cells and their differentiation to neural lineages.
More...

AA Sequence

MPGGCSRGPAAGDGRLRLARLALVLLGWVSSSSPTSSASSFSSSAPFLASAVSAQPPLPDQCPALCECSE      1 - 70
AARTVKCVNRNLTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAELAALNLSGSRLDEVRAGAFEH     71 - 140
LPSLRQLDLSHNPLADLSPFAFSGSNASVSAPSPLVELILNHIVPPEDERQNRSFEGMVVAALLAGRALQ    141 - 210
GLRRLELASNHFLYLPRDVLAQLPSLRHLDLSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAE    211 - 280
LQGLPHIRVFLDNNPWVCDCHMADMVTWLKETEVVQGKDRLTCAYPEKMRNRVLLELNSADLDCDPILPP    281 - 350
SLQTSYVFLGIVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV    351 - 420
//

Text Mined References (25)

PMID Year Title
25738465 2015 Trophoblast glycoprotein promotes pancreatic ductal adenocarcinoma cell metastasis through Wnt/planar cell polarity signaling.
25066861 2014 Understanding and exploiting 5T4 oncofoetal glycoprotein expression.
24582434 2014 Structural insights into the inhibition of Wnt signaling by cancer antigen 5T4/Wnt-activated inhibitory factor 1.
22956548 2012 CXCL12 receptor preference, signal transduction, biological response and the expression of 5T4 oncofoetal glycoprotein.
22498111 2012 Overexpression and potential targeting of the oncofoetal antigen 5T4 in malignant pleural mesothelioma.
22100263 2011 Waif1/5T4 inhibits Wnt/?-catenin signaling and activates noncanonical Wnt pathways by modifying LRP6 subcellular localization.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18833005 An MVA-based vaccine targeting the oncofetal antigen 5T4 in patients undergoing surgical resection of colorectal cancer liver metastases.
18567615 2008 Identification and functional validation of MHC class I epitopes in the tumor-associated antigen 5T4.
More...