Property Summary

NCBI Gene PubMed Count 23
PubMed Score 136.89
PubTator Score 50.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.500 1.8e-02
Atopic dermatitis 1.200 6.3e-05
chronic kidney disease 1.300 1.7e-02
cystic fibrosis 2.274 2.8e-07
ependymoma 1.300 1.6e-03
interstitial cystitis -1.100 6.4e-03
intraductal papillary-mucinous adenoma (... 1.300 2.2e-03
intraductal papillary-mucinous carcinoma... 1.200 2.1e-02
lung adenocarcinoma 1.797 1.8e-06
lung cancer 1.400 1.2e-03
malignant mesothelioma -2.100 1.8e-07
non-small cell lung cancer 1.870 2.9e-23
osteosarcoma 1.415 1.4e-02
ovarian cancer -4.100 5.6e-11
pancreatic cancer 1.100 1.1e-05
pancreatic ductal adenocarcinoma liver m... 2.380 2.0e-03
psoriasis 1.800 2.3e-14
ulcerative colitis 1.200 8.9e-07

Gene RIF (12)

AA Sequence

MPGGCSRGPAAGDGRLRLARLALVLLGWVSSSSPTSSASSFSSSAPFLASAVSAQPPLPDQCPALCECSE      1 - 70
AARTVKCVNRNLTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAELAALNLSGSRLDEVRAGAFEH     71 - 140
LPSLRQLDLSHNPLADLSPFAFSGSNASVSAPSPLVELILNHIVPPEDERQNRSFEGMVVAALLAGRALQ    141 - 210
GLRRLELASNHFLYLPRDVLAQLPSLRHLDLSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAE    211 - 280
LQGLPHIRVFLDNNPWVCDCHMADMVTWLKETEVVQGKDRLTCAYPEKMRNRVLLELNSADLDCDPILPP    281 - 350
SLQTSYVFLGIVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV    351 - 420
//

Text Mined References (26)

PMID Year Title