Property Summary

NCBI Gene PubMed Count 82
PubMed Score 789.58
PubTator Score 116.62

Knowledge Summary

Patent (16,522)

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
osteosarcoma 7933 1.35134885653231E-10
colon cancer 1475 4.08919945414036E-8
ovarian cancer 8492 7.10994267708238E-6
medulloblastoma 1524 1.36319353693405E-5
psoriasis 6685 2.19158286134391E-5
non diabetic and post-ischemic heart failure 200 0.00108758757812675
glioblastoma 5572 0.00137967858820901
primitive neuroectodermal tumor 3031 0.0021443418907768
type II diabetes mellitus and post-ischemic heart failure 89 0.00570918189536897
Multiple myeloma 1328 0.00582791451573722
non primary Sjogren syndrome sicca 840 0.0268370623445184
aldosterone-producing adenoma 664 0.0404860528259974
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 0.0 2.0

Expression

  Differential Expression (12)

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

  TechDev Info (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
434953 screening 0 / 0 / 0 Late-stage radioligand binding dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Ki

Gene RIF (64)

PMID Text
25622143 This study demonistrated that 5-hydroxytryptamine (serotonin) receptor 4 regulate memory.
25522384 Data suggest that the 5-HT4 receptor is involved in the neurobiological mechanism underlying familial risk for depression, and that lower striatal 5-HT4 receptor binding is associated with increased risk for developing major depression disorder
25342126 The findings of altered lung function and increased AHR in Htr4-null mice support a causal relationship between genetic variation in HTR4 and pulmonary function identified in human genome-wide association studies.
25101859 PDE3A1 and PDE4D3 are integrated into complexes that contain the 5-HT4(b) receptor and may thereby regulate 5-HT4(b) receptor-mediated signaling.
24951661 ADAM19 rs1422795 and HTR4 rs11168048 are associated with pulmonary function.
23890215 Taken together, these data suggest a role for HTR4 in lung development, which may at least in part explain the genetic association with lung function.
23474291 Stimulation of central 5-HT4 receptors is potentially disease-modifying in a transgenic mouse model of Alzheimer's disease.
23307014 This is the first transgenic model to study human 5-HTreceptor in the atrium ex vivo or in vivo.
22903372 These results suggest a prominent role of 5-HT(4)R in promoting angiogenesis.
22842674 Our results suggest that HTR4 polymorphisms may not play a major role in the susceptibility for suicidal behavior in subjects with schizophrenia.
More...

AA Sequence

MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVS      1 - 70
VLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIAL     71 - 140
MLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVL    141 - 210
AYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNI    211 - 280
VDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTT    281 - 350
INGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT                                    351 - 388
//

Text Mined References (85)

PMID Year Title
25622143 2015 Astrocytic adenosine receptor A2A and Gs-coupled signaling regulate memory.
25522384 2014 Familial risk for major depression is associated with lower striatal 5-HT? receptor binding.
25342126 2015 Genetic variation in HTR4 and lung function: GWAS follow-up in mouse.
25101859 2014 Phosphodiesterase 4 interacts with the 5-HT4(b) receptor to regulate cAMP signaling.
24951661 2014 ADAM19 and HTR4 variants and pulmonary function: Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) Consortium Targeted Sequencing Study.
23890215 2013 HTR4 gene structure and altered expression in the developing lung.
23474291 2013 Chronic 5-HT4 receptor activation decreases A? production and deposition in hAPP/PS1 mice.
23307014 2013 Human 5-HT?receptor stimulation in atria of transgenic mice.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
22903372 2013 A novel regulator of angiogenesis in endothelial cells: 5-hydroxytriptamine 4 receptor.
More...