Property Summary

NCBI Gene PubMed Count 82
Grant Count 77
R01 Count 50
Funding $8,545,342.16
PubMed Score 789.58
PubTator Score 116.62

Knowledge Summary

Patent (16,522)

Expression

  Differential Expression (12)

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
434953 screening 0 / 0 / 0 Late-stage radioligand binding dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Ki

Gene RIF (64)

PMID Text
25622143 This study demonistrated that 5-hydroxytryptamine (serotonin) receptor 4 regulate memory.
25522384 Data suggest that the 5-HT4 receptor is involved in the neurobiological mechanism underlying familial risk for depression, and that lower striatal 5-HT4 receptor binding is associated with increased risk for developing major depression disorder
25342126 The findings of altered lung function and increased AHR in Htr4-null mice support a causal relationship between genetic variation in HTR4 and pulmonary function identified in human genome-wide association studies.
25101859 PDE3A1 and PDE4D3 are integrated into complexes that contain the 5-HT4(b) receptor and may thereby regulate 5-HT4(b) receptor-mediated signaling.
24951661 ADAM19 rs1422795 and HTR4 rs11168048 are associated with pulmonary function.
23890215 Taken together, these data suggest a role for HTR4 in lung development, which may at least in part explain the genetic association with lung function.
23474291 Stimulation of central 5-HT4 receptors is potentially disease-modifying in a transgenic mouse model of Alzheimer's disease.
23307014 This is the first transgenic model to study human 5-HTreceptor in the atrium ex vivo or in vivo.
22903372 These results suggest a prominent role of 5-HT(4)R in promoting angiogenesis.
22842674 Our results suggest that HTR4 polymorphisms may not play a major role in the susceptibility for suicidal behavior in subjects with schizophrenia.
More...

AA Sequence

MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVS      1 - 70
VLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIAL     71 - 140
MLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVL    141 - 210
AYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNI    211 - 280
VDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTT    281 - 350
INGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT                                    351 - 388
//

Text Mined References (85)

PMID Year Title
25622143 2015 Astrocytic adenosine receptor A2A and Gs-coupled signaling regulate memory.
25522384 2014 Familial risk for major depression is associated with lower striatal 5-HT? receptor binding.
25342126 2015 Genetic variation in HTR4 and lung function: GWAS follow-up in mouse.
25101859 2014 Phosphodiesterase 4 interacts with the 5-HT4(b) receptor to regulate cAMP signaling.
24951661 2014 ADAM19 and HTR4 variants and pulmonary function: Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) Consortium Targeted Sequencing Study.
23890215 2013 HTR4 gene structure and altered expression in the developing lung.
23474291 2013 Chronic 5-HT4 receptor activation decreases A? production and deposition in hAPP/PS1 mice.
23307014 2013 Human 5-HT?receptor stimulation in atria of transgenic mice.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
22903372 2013 A novel regulator of angiogenesis in endothelial cells: 5-hydroxytriptamine 4 receptor.
More...