Property Summary

NCBI Gene PubMed Count 19
Grant Count 6
R01 Count 2
Funding $605,922.33
PubMed Score 29.87
PubTator Score 13.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma 1.500 0.005
atypical teratoid / rhabdoid tumor 1.200 0.000
lung cancer -1.700 0.013
posterior fossa group A ependymoma 1.200 0.000
sonic hedgehog group medulloblastoma 1.100 0.000
lung carcinoma -1.200 0.000
gastric carcinoma 1.100 0.027
ovarian cancer 1.200 0.002

Gene RIF (10)

PMID Text
26882978 Rab32 controls intracellular lipid accumulation through inducing lipolysis via enhancing ATGL expression indirectly.
25360523 Rab32 may regulate the physiological functions of LRRK2.
25324551 Rab38 and its close homolog Rab32 bind to Myosin Vc but not to Myosin Va or Myosin Vb. Binding depends on residues in the switch II region of Rab32 and Rab38 and regions of the Myosin Vc coiled-coil tail domain.
23084991 BLOC-3 is a Rab32 and Rab38 guanine nucleotide exchange factor, with a specific function in the biogenesis of lysosome-related organelles.
22511774 that Rab38 and Rab32 are the specific factors that direct the ubiquitous machinery to mediate transport from early endosomes to maturing LROs.
22019778 Identification of two new loci at IL23R and RAB32 that influence susceptibility to leprosy
20877624 Observational study of gene-disease association. (HuGE Navigator)
19593531 Results suggest that Rab32 facilitates the formation of autophagic vacuoles whose membranes are derived from the ER and regulates the clearance of aggregated proteins by autophagy.
16557577 RAB32 inactivation may represent a component of the oncogenic pathway of microsatellite-unstable gastrointestinal adenocarcinomas
12186851 Rab32 is a dual function protein that participates in both mitochondrial anchoring of PKA and synchronization of mitochondrial fission.

AA Sequence

MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWD      1 - 70
SRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVL     71 - 140
LANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIK    141 - 210
LDQETLRAENKSQCC                                                           211 - 225
//

Text Mined References (27)

PMID Year Title
26882978 2016 Depletion of Rab32 decreases intracellular lipid accumulation and induces lipolysis through enhancing ATGL expression in hepatocytes.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25767741 Interaction with the effector dynamin-related protein 1 (Drp1) is an ancient function of Rab32 subfamily proteins.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
25360523 2014 LRRK2 transport is regulated by its novel interacting partner Rab32.
25324551 2014 Myosin vc interacts with Rab32 and Rab38 proteins and works in the biogenesis and secretion of melanosomes.
24856514 2014 VARP is recruited on to endosomes by direct interaction with retromer, where together they function in export to the cell surface.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23084991 2012 BLOC-3 mutated in Hermansky-Pudlak syndrome is a Rab32/38 guanine nucleotide exchange factor.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...