Property Summary

NCBI Gene PubMed Count 20
PubMed Score 33.38
PubTator Score 13.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.8e-04
gastric carcinoma 1.100 2.7e-02
glioblastoma 1.500 5.0e-03
lung cancer -1.700 1.3e-02
lung carcinoma -1.200 1.8e-21
ovarian cancer 1.200 2.2e-03
posterior fossa group A ependymoma 1.200 3.1e-08
sonic hedgehog group medulloblastoma 1.100 2.5e-04

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (11)

AA Sequence

MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWD      1 - 70
SRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVL     71 - 140
LANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIK    141 - 210
LDQETLRAENKSQCC                                                           211 - 225
//

Text Mined References (29)

PMID Year Title