Property Summary

NCBI Gene PubMed Count 23
PubMed Score 13.45
PubTator Score 15.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.0396614722196E-34
astrocytoma 1493 2.84308599184359E-28
glioblastoma multiforme 347 1.44435624358327E-27
breast carcinoma 1614 1.15254058501263E-13
Duchenne muscular dystrophy 602 5.59511692861779E-10
pilocytic astrocytoma 3086 2.27724964811794E-9
juvenile dermatomyositis 1189 2.97981496937748E-9
ovarian cancer 8492 4.65812942909147E-8
group 3 medulloblastoma 2254 2.84494562993346E-7
limb girdle muscular dystrophy 2A 156 4.89485817798906E-7
ulcerative colitis 2087 5.91568026521607E-7
medulloblastoma, large-cell 6234 2.66758045077774E-6
interstitial cystitis 2299 8.98684907188201E-6
malignant mesothelioma 3163 1.05100989937375E-5
psoriasis 6685 1.86787632443354E-5
lung adenocarcinoma 2714 1.87801890565818E-5
pituitary cancer 1972 2.24723024305157E-5
lung cancer 4473 6.77793782547587E-5
posterior fossa group A ependymoma 1511 7.96674689496485E-5
pancreatic cancer 2300 1.14471820135979E-4
primary pancreatic ductal adenocarcinoma 1271 1.28237903702559E-4
osteosarcoma 7933 4.11987044773548E-4
invasive ductal carcinoma 2950 4.67363760644321E-4
Becker muscular dystrophy 187 0.00127584608858635
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00410072468612199
gastric carcinoma 832 0.00666710917480611
mucosa-associated lymphoid tissue lymphoma 480 0.00772401964201853
primary Sjogren syndrome 789 0.0100824534111221
oligodendroglioma 2849 0.0109785102451434
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.026478621190164
Breast cancer 3099 0.0270162221104319
aldosterone-producing adenoma 664 0.0280905963543727
chronic lymphocytic leukemia 244 0.046079133529683

Expression

Synonym

Accession Q13636 B2RBT7 Q15770 Q9HC00
Symbols Rab22B

Gene

PDB

2FG5  

  Ortholog (9)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (10)

PMID Text
26044564 this study provides the evidence of Rab31 overexpression in HCC, and Rab31 is potentially used as a novel biomarker of poor prognosis in patients with HCC. PI3K/AKT/Bcl-2/BAX axis was involved in Rab31-promoting HCC progression.
24644286 Data indicate that early endosome antigen 1 (EEA1) is important for the small GTPase Rab31-mediated enhancement of ligand-bound EGF receptor (EGFR) endocytic trafficking.
22920728 Overexpression of rab31 in breast cancer cells leads to a switch from an invasive to a proliferative phenotype as indicated by an increased cell proliferation, reduced adhesion and invasion in vitro, and a reduced capacity to form lung metastases in vivo.
22792175 MUC1-C and Rab31 function in an autoinductive loop that contributes to overexpression of MUC1-C in breast cancer cells.
21848504 Neither UPARwt, nor UPAR-del4/5 nor RAB31 mRNA expression levels were found to be prognostic markers in advanced ovarian cancer.
21586568 RIN3 specifically acts as a GEF for Rab31.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19725050 Rab22B possibly plays role in regulating epidermal growth factor receptor (EGFR) and mannose 6-phosphate receptor (M6PR) transport into late endosomes.
17952591 uPAR-del4/5 and rab31 mRNA represent independent prognostic markers in breast cancer and may be components of different, but possibly associated, tumor-relevant signaling pathways.
17678623 Thus, Rab22B may have a role in anterograde exit from the trans-Golgi network .

AA Sequence

MAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSL      1 - 70
APMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESI     71 - 140
GAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC                    141 - 194
//

Text Mined References (29)

PMID Year Title
26044564 2015 Rab31 promoted hepatocellular carcinoma (HCC) progression via inhibition of cell apoptosis induced by PI3K/AKT/Bcl-2/BAX pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24644286 2014 Engagement of the small GTPase Rab31 protein and its effector, early endosome antigen 1, is important for trafficking of the ligand-bound epidermal growth factor receptor from the early to the late endosome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22920728 2012 Rab31 expression levels modulate tumor-relevant characteristics of breast cancer cells.
22792175 2012 Cooperative interaction between the MUC1-C oncoprotein and the Rab31 GTPase in estrogen receptor-positive breast cancer cells.
21848504 2011 mRNA expression levels of the biological factors uPAR, uPAR-del4/5, and rab31, displaying prognostic value in breast cancer, are not clinically relevant in advanced ovarian cancer.
21586568 2011 Characterization of RIN3 as a guanine nucleotide exchange factor for the Rab5 subfamily GTPase Rab31.
21269460 2011 Initial characterization of the human central proteome.
More...