Property Summary

NCBI Gene PubMed Count 24
PubMed Score 14.77
PubTator Score 15.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (33)

Disease log2 FC p
aldosterone-producing adenoma -1.142 4.9e-02
astrocytoma 1.400 9.7e-30
Astrocytoma, Pilocytic 1.900 3.1e-10
Becker muscular dystrophy 1.017 1.3e-03
Breast cancer 2.800 2.7e-02
breast carcinoma 1.100 1.6e-14
Chronic Lymphocytic Leukemia 1.019 3.2e-02
Duchenne muscular dystrophy 1.276 5.1e-09
ependymoma -1.100 6.0e-04
gastric carcinoma 2.400 6.7e-03
glioblastoma 1.300 5.5e-03
group 3 medulloblastoma -2.900 5.6e-08
interstitial cystitis 1.200 2.1e-03
intraductal papillary-mucinous adenoma (... -1.400 4.1e-03
intraductal papillary-mucinous carcinoma... -1.300 2.6e-02
invasive ductal carcinoma 1.981 5.7e-04
juvenile dermatomyositis 1.140 3.0e-09
limb girdle muscular dystrophy 2A 1.001 4.9e-07
lung adenocarcinoma -1.300 1.9e-05
lung cancer -1.100 2.2e-02
lung carcinoma -2.100 4.0e-34
malignant mesothelioma -1.100 1.8e-05
medulloblastoma, large-cell -3.500 2.4e-06
mucosa-associated lymphoid tissue lympho... 2.103 7.7e-03
oligodendroglioma 1.400 4.1e-02
osteosarcoma 1.492 4.1e-04
ovarian cancer -2.400 1.3e-08
pancreatic cancer 1.400 2.6e-03
pituitary cancer -1.400 3.5e-05
primary pancreatic ductal adenocarcinoma 2.864 3.2e-05
primary Sjogren syndrome 1.300 1.0e-02
psoriasis 1.300 1.9e-07
ulcerative colitis 3.000 5.9e-07

Protein-protein Interaction (8)

Gene RIF (11)

AA Sequence

MAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSL      1 - 70
APMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESI     71 - 140
GAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC                    141 - 194
//

Text Mined References (30)

PMID Year Title