Property Summary

NCBI Gene PubMed Count 15
PubMed Score 14.03
PubTator Score 12.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis 2.700 0.000
osteosarcoma -1.020 0.037
Atopic dermatitis 1.100 0.002
intraductal papillary-mucinous adenoma (... 1.300 0.000
active ulcerative colitis 1.652 0.005
pancreatic cancer 1.100 0.000
diabetes mellitus -1.200 0.005
lung adenocarcinoma 1.200 0.000
Breast cancer 1.500 0.000
lung carcinoma 1.300 0.000
non-small cell lung carcinoma 1.200 0.000
breast carcinoma 1.200 0.000
ductal carcinoma in situ 1.700 0.003
invasive ductal carcinoma 1.400 0.008
ovarian cancer 2.000 0.000

Synonym

Accession Q13630 B2R8Y7 D3DWK5 Q567Q9 Q9UDG7
Symbols FX
P35B
SDR4E1

Gene

PANTHER Protein Class (2)

PDB

4B8W   4B8Z   4BKP   4BL5   4E5Y  

Gene RIF (3)

PMID Text
23774504 Data indicate that the structure of GDP-l-fucose synthase (FX) reveals the key catalytic residues.
22944692 Positional proteomics analysis identifies the cleavage of human GDP-L-fucose synthase (TSTA3: tissue specific transplantation antigen P35B) at amino acid residues 40-41 by the HIV-1 protease
22528125 Tissue-specific transplantation antigen P35B (TSTA3) immune response-mediated metabolism coupling cell cycle to postreplication repair network in no-tumor hepatitis/cirrhotic tissues (HBV or HCV

AA Sequence

MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLA      1 - 70
AMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSN     71 - 140
FGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGT    141 - 210
GNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQF    211 - 280
KKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK                                 281 - 321
//

Text Mined References (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23774504 2013 The crystal structure of human GDP-L-fucose synthase.
23585552 2013 Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment.
22528125 2012 Tissue-specific transplantation antigen P35B (TSTA3) immune response-mediated metabolism coupling cell cycle to postreplication repair network in no-tumor hepatitis/cirrhotic tissues (HBV or HCV infection) by biocomputation.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...