Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.32
PubTator Score 12.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active ulcerative colitis 1.309 4.6e-03
Atopic dermatitis 1.100 2.1e-03
Breast cancer 1.500 1.0e-15
breast carcinoma 1.200 2.6e-24
diabetes mellitus -1.200 5.1e-03
ductal carcinoma in situ 1.300 8.1e-03
intraductal papillary-mucinous adenoma (... 1.300 1.6e-04
invasive ductal carcinoma 1.200 1.5e-02
lung adenocarcinoma 1.200 2.1e-07
lung carcinoma 1.300 1.3e-17
non-small cell lung carcinoma 1.200 3.8e-23
osteosarcoma -1.020 3.7e-02
ovarian cancer 1.300 2.7e-04
pancreatic cancer 1.100 3.4e-05
psoriasis 2.700 7.0e-06

Synonym

Accession Q13630 B2R8Y7 D3DWK5 Q567Q9 Q9UDG7
Symbols FX
P35B
SDR4E1

Gene

PANTHER Protein Class (2)

PDB

4B8W   4B8Z   4BKP   4BL5   4E5Y  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLA      1 - 70
AMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSN     71 - 140
FGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGT    141 - 210
GNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQF    211 - 280
KKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK                                 281 - 321
//

Text Mined References (18)

PMID Year Title