Property Summary

NCBI Gene PubMed Count 120
Grant Count 78
R01 Count 58
Funding $9,794,035.82
PubMed Score 466.86
PubTator Score 204.94

Knowledge Summary

Patent (17,572)

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.176 0.035
Multiple myeloma 2.066 0.001
osteosarcoma 1.552 0.000
juvenile dermatomyositis 1.075 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.012
acute myeloid leukemia 1.200 0.016
ovarian cancer -1.600 0.000
dermatomyositis 1.300 0.000

Synonym

Accession Q13627 O60769 Q92582 Q92810 Q9UNM5
Symbols MNB
DYRK
HP86
MNBH
MRD7
DYRK1

Gene

PDB

2VX3   2WO6   3ANQ   3ANR   4AZE   4MQ1   4MQ2   4NCT   4YLJ   4YLK   4YLL   4YU2   5A3X   5A4E   5A4L   5A4Q   5A4T   5A54   5AIK  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
2705 confirmatory 87 / 10 / 4 Assay for Inhibitors of Dual-Specificity Tyrosine-(Y)-Phosphorylation Regulated Kinase 1A (Kinase-Glo assay)
2710 other 28 / 0 / 0 Kinase Inhibition Profile Study on Inhibitors of CDC-like Kinase 4
488872 summary 29 / 0 / 0 qHTS for Inhibitors of DYRK1A: Summary
493206 confirmatory 122 / 24 / 7 Assay for Inhibitors of Dual-Specificity Tyrosine-(Y)-Phosphorylation Regulated Kinase 1A (Kinase-Glo assay): round 2 SAR
504424 confirmatory 59 / 0 / 6 Kinase Inhibition Study on Inhibitors of Dyrk1a (Reaction Biology data)
624045 confirmatory 30 / 0 / 3 Reaction Biology data for inhibitors of DYRK1A: Probe SAR
624093 confirmatory 79 / 29 / 25 Confirmation Assay for Inhibitors of Dyrk1a (Kinase-Glo Assay): KU probe

Gene RIF (89)

PMID Text
27100087 RNA-seq evidence of biallelic expression of DYRK1A and 10 neighboring genes in at least one primary human tissue tested indicates that the expression of DYRK1A is uncoupled from the control of the maternally inherited 5mCpG imprints at the WRB differentially methylated region (DMR) in disomic controls or trisomy (Down syndrome) individuals.
26922654 A de novo splice site mutation and a de novo nonsense mutation in DYRK1A were identified in two patients with syndromic intellectual disability.
26641855 data indicate that host factor DYRK1A plays a role in the regulation of viral transcription and latency.
26534959 the increased immunostaining of DYRK1A in HIV+ brains without pathology points at dysregulation of DYRK1A as an early event in the neuronal complications of HIV infection.
26496802 Inhibition of DYRK1A and GSK3B induces human beta-cell proliferation
26137545 Cyclin D1 Again Caught in the Act: Dyrk1a Links G1 and Neurogenesis in Down Syndrome.
25944381 Our report represents the largest cohort of individuals with DYRK1A disruptions to date, and is the first attempt to define consistent genotype-phenotype correlations among subjects with 21q22.13 microdeletions and DYRK1A SNVs or small INDELs.
25920557 We identified unique truncating and non-synonymous mutations (three nonsense, four frameshift and two missense) in DYRK1A in nine patients and a large chromosomal deletion that encompassed DYRK1A in one patient
25918155 findings suggest that truncation/activation of Dyrk1A by Ca(2+)/calpain I might contribute to Tau pathology via promotion of exon 10 exclusion and hyperphosphorylation of Tau in AD brain
25707398 mutations in DYRK1A define a syndromic form of autism spectrum disorder and intellectual disability with neurodevelopmental defects consistent with murine and Drosophila knockout models
More...

AA Sequence

MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQV      1 - 70
MPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGY     71 - 140
DDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELM    141 - 210
NKHDTEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPE    211 - 280
LSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCI    281 - 350
LVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWNLKKTKDGKREYKPPGT    351 - 420
RKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTNTS    421 - 490
NSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGGHFTAAVQAMDCETHSPQVRQ    491 - 560
QFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHHHHGNSSHHHHHHHHHHHHHGQQALGNRTRP    561 - 630
RVYNSPTNSSSTQDSMEVGHSHHSMTSLSSSTTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDV    631 - 700
NLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS           701 - 763
//

Text Mined References (132)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27100087 2016 Trisomy 21 Alters DNA Methylation in Parent-of-Origin-Dependent and -Independent Manners.
26922654 2016 Case report of novel DYRK1A mutations in 2 individuals with syndromic intellectual disability and a review of the literature.
26641855 2015 DYRK1A Controls HIV-1 Replication at a Transcriptional Level in an NFAT Dependent Manner.
26534959 2015 HIV-1-Tat Protein Inhibits SC35-mediated Tau Exon 10 Inclusion through Up-regulation of DYRK1A Kinase.
26496802 2015 Inhibition of DYRK1A and GSK3B induces human ?-cell proliferation.
26137545 2015 Cyclin D1 Again Caught in the Act: Dyrk1a Links G1 and Neurogenesis in Down Syndrome.
25944381 2015 DYRK1A haploinsufficiency causes a new recognizable syndrome with microcephaly, intellectual disability, speech impairment, and distinct facies.
25920557 2015 Ten new cases further delineate the syndromic intellectual disability phenotype caused by mutations in DYRK1A.
25918155 2015 Truncation and Activation of Dual Specificity Tyrosine Phosphorylation-regulated Kinase 1A by Calpain I: A MOLECULAR MECHANISM LINKED TO TAU PATHOLOGY IN ALZHEIMER DISEASE.
More...