Property Summary

NCBI Gene PubMed Count 85
Grant Count 31
R01 Count 19
Funding $1,959,269.47
PubMed Score 68.43
PubTator Score 72.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.317 0.000
group 4 medulloblastoma 1.200 0.001
acute myeloid leukemia 2.400 0.014
ovarian cancer 1.200 0.003
Down syndrome 1.100 0.017

 GWAS Trait (1)

Gene RIF (49)

PMID Text
26663100 miR-548d-3p/TP53BP2 pathway is critically involved in the proliferation and apoptosis of breast cancer cells and may be new therapeutic target of breast cancer cells.
26595804 ASPP1/2-PP1 complexes are required for chromosome segregation and kinetochore-microtubule attachments.
26438046 ASSP2 expression is lower in cancerous tissues and decreased ASPP2 lead to higher cancer cells proliferation and autophagic flux, which contribute to the gemcitabine resistance.
25963096 These results identify previously uncharacterized regions distributed throughout the protein sequence of ASPP2 as determinants of CagA binding, providing mechanistic insight into apoptosis reprogramming by CagA.
25660448 ASPP1/2 interacted with centrosome linker protein C-Nap1. Co-depletion of ASPP1 and ASPP2 inhibited re-association of C-Nap1 with centrosome at the end of mitosis.
25534115 this study revealed a novel function of ASPP2 in modulating autophagy and apoptosis.
25436413 these observations reveal that Itch and Yap1 have antagonistic roles in the regulation of ASPP2 protein stability through competing post-translational regulatory mechanism of ASPP2.
25360797 ASPP2 directly induces the dephosphorylation and activation of junctional YAP
25344754 ASPP2 prevents beta-catenin from transactivating ZEB1 directly by forming an ASPP2-beta-catenin-E-cadherin ternary complex
25256142 ASPP2 may participate in the lipid metabolism of non-alcoholic steatohepatitis and attenuate liver failure.
More...

AA Sequence

MMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVADNERMFDVLQRFG      1 - 70
SQRNEVRFFLRHERPPGRDIVSGPRSQDPSLKRNGVKVPGEYRRKENGVNSPRMDLTLAELQEMASRQQQ     71 - 140
QIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKLKRLKEIAENQEAKLKKVRALKGHVEQKRLSNGKL    141 - 210
VEEIEQMNNLFQQKQRELVLAVSKVEELTRQLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQ    211 - 280
NAKLQQQRECLNKRNSEVAVMDKRVNELRDRLWKKKAALQQKENLPVSSDGNLPQQAASAPSRVAAVGPY    281 - 350
IQSSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADL    351 - 420
FPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQV    421 - 490
ANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIP    491 - 560
SVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSA    561 - 630
LTKTHTRGPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPT    631 - 700
KLLPFLSNPYRNQSDADLEALRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSY    701 - 770
PSKSASVTASSESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDN    771 - 840
SPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPEGPGEDSVSMRPPEITGQVSLPPGKRTNLRK    841 - 910
TGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQ    911 - 980
FGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGV    981 - 1050
QEKMGIMNKGVIYALWDYEPQNDDELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRI   1051 - 1120
KPRQRSLA                                                                 1121 - 1128
//

Text Mined References (95)

PMID Year Title
26663100 2016 miR-548d-3p/TP53BP2 axis regulates the proliferation and apoptosis of breast cancer cells.
26595804 2015 ASPP1/2-PP1 complexes are required for chromosome segregation and kinetochore-microtubule attachments.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26438046 2015 Downregulation of ASPP2 in pancreatic cancer cells contributes to increased resistance to gemcitabine through autophagy activation.
25963096 2015 An Intrinsically Disordered Region in the Proapoptotic ASPP2 Protein Binds to the Helicobacter pylori Oncoprotein CagA.
25660448 2015 The tumor suppressor proteins ASPP1 and ASPP2 interact with C-Nap1 and regulate centrosome linker reassembly.
25547411 2014 Identifying tandem Ankyrin repeats in protein structures.
25534115 2015 ASPP2 enhances oxaliplatin (L-OHP)-induced colorectal cancer cell apoptosis in a p53-independent manner by inhibiting cell autophagy.
25436413 2015 The E3 ubiquitin ligase Itch and Yap1 have antagonistic roles in the regulation of ASPP2 protein stability.
25416956 2014 A proteome-scale map of the human interactome network.
More...