Property Summary

NCBI Gene PubMed Count 111
PubMed Score 80.08
PubTator Score 66.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.208 9.8e-05
astrocytic glioma 1.100 1.1e-02
atypical teratoid / rhabdoid tumor 1.100 4.8e-07
Breast cancer -2.200 4.9e-02
cystic fibrosis and chronic rhinosinusit... 1.253 7.1e-03
ependymoma 1.300 1.0e-02
group 3 medulloblastoma 1.100 7.0e-04
hepatocellular carcinoma -1.200 3.7e-04
intraductal papillary-mucinous neoplasm ... 1.100 4.4e-03
oligodendroglioma 1.500 5.8e-03
osteosarcoma 1.129 2.9e-03
ovarian cancer 1.200 1.2e-03
pituitary cancer -1.300 5.4e-04
tuberculosis and treatment for 6 months 1.400 6.0e-04

Protein-protein Interaction (5)

Gene RIF (105)

AA Sequence

MADEAPRKGSFSALVGRTNGLTKPAALAAAPAKPGGAGGSKKLVIKNFRDRPRLPDNYTQDTWRKLHEAV      1 - 70
RAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILPFREDSLDSVLFLKKINTCWQ     71 - 140
DHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRTHIISDKMVQSKTIDGILLLIERERSGEAVD    141 - 210
RSLLRSLLGMLSDLQVYKDSFELKFLEETNCLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDH    211 - 280
STQKPLIACVEKQLLGEHLTAILQKGLDHLLDENRVPDLAQMYQLFSRVRGGQQALLQHWSEYIKTFGTA    281 - 350
IVINPEKDKDMVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRPNKPAELIAKHVDSKLRAG    351 - 420
NKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSK    421 - 490
LEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLG    491 - 560
KHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQS    561 - 630
LACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAI    631 - 700
VRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA               701 - 759
//

Text Mined References (128)

PMID Year Title