Property Summary

NCBI Gene PubMed Count 96
Grant Count 88
R01 Count 74
Funding $5,985,464.81
PubMed Score 71.25
PubTator Score 66.06

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

PANTHER Protein Class (2)

PDB

2HYE   4A0K  

Gene RIF (110)

PMID Text
26965998 this study proposes that inflammation-induced Jak-STAT3 signaling leads to colon cancer development through proteasomal degradation of DICER1 by ubiquitin ligase complex of CUL4A(DCAF1), which suggests a novel therapeutic opportunity for colon cancer
26684807 Amplification of CUL4A, IRS2, and TFDP1 genes showed a significant difference in disease-free survival by both univariate and multivariate survival analyses in intrahepatic cholangiocarcinoma.
26593394 CUL4A facilitates hepatocarcinogenesis by promoting cell cycle progression and epithelial-mesenchymal transition.
26503734 We observed that knockdown of Cul4A was associated with increased sensitivity to gemcitabine through upregulation of TGFBI in lung cancer cells.
26218750 These results suggest a linkage between Cul4A and Gli1 expression in human mesothelioma.
26104890 PR-Set7 is a direct target of Cul4A for degradation and involved in the formation of lung tumors in the conditional Cul4A transgenic mouse model.
26036759 Our results indicate that CUL4A overexpression play an oncogenic role in the pathogenesis of prostate cancer (PC), and CUL4A may be a potential therapeutic target for PCa.
26021757 Our data are consistent with the idea that the CUL4A/B-DDB1-CRBN complex catalyses the polyubiquitination and thus controls the degradation of CLC-1 channels.
25807049 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
25807049 Both HIV-2 Vpr and SIVmac239 Vpr induces G2 cell cycle arrest through either CUL4A or CUL4B
More...

AA Sequence

MADEAPRKGSFSALVGRTNGLTKPAALAAAPAKPGGAGGSKKLVIKNFRDRPRLPDNYTQDTWRKLHEAV      1 - 70
RAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILPFREDSLDSVLFLKKINTCWQ     71 - 140
DHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRTHIISDKMVQSKTIDGILLLIERERSGEAVD    141 - 210
RSLLRSLLGMLSDLQVYKDSFELKFLEETNCLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDH    211 - 280
STQKPLIACVEKQLLGEHLTAILQKGLDHLLDENRVPDLAQMYQLFSRVRGGQQALLQHWSEYIKTFGTA    281 - 350
IVINPEKDKDMVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRPNKPAELIAKHVDSKLRAG    351 - 420
NKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSK    421 - 490
LEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLG    491 - 560
KHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQS    561 - 630
LACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAI    631 - 700
VRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA               701 - 759
//

Text Mined References (112)

PMID Year Title
26965998 2016 Jak-STAT3 pathway triggers DICER1 for proteasomal degradation by ubiquitin ligase complex of CUL4A(DCAF1) to promote colon cancer development.
26684807 2015 Recurrent Amplification at 13q34 Targets at CUL4A, IRS2, and TFDP1 As an Independent Adverse Prognosticator in Intrahepatic Cholangiocarcinoma.
26593394 2015 CUL4A facilitates hepatocarcinogenesis by promoting cell cycle progression and epithelial-mesenchymal transition.
26503734 2015 Knockdown of Cul4A increases chemosensitivity to gemcitabine through upregulation of TGFBI in lung cancer cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26218750 2015 Cul4A overexpression associated with Gli1 expression in malignant pleural mesothelioma.
26104890 2015 PR-Set7 is Degraded in a Conditional Cul4A Transgenic Mouse Model of Lung Cancer.
26036759 2015 Clinical significance of CUL4A in human prostate cancer.
26021757 2015 The Cullin 4A/B-DDB1-Cereblon E3 Ubiquitin Ligase Complex Mediates the Degradation of CLC-1 Chloride Channels.
25542213 2015 Cullin 4A and 4B ubiquitin ligases interact with ?-tubulin and induce its polyubiquitination.
More...