Property Summary

NCBI Gene PubMed Count 118
PubMed Score 1670.77
PubTator Score 134.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -2.300 1.6e-06
astrocytic glioma -1.800 1.3e-02
Astrocytoma, Pilocytic -2.000 1.1e-07
atypical teratoid / rhabdoid tumor -3.000 4.2e-11
Breast cancer -1.300 2.8e-19
ependymoma -1.900 2.4e-02
glioblastoma -2.000 1.9e-08
group 4 medulloblastoma -1.400 3.0e-04
intraductal papillary-mucinous adenoma (... 1.800 4.4e-04
intraductal papillary-mucinous carcinoma... 1.800 7.2e-04
intraductal papillary-mucinous neoplasm ... 1.500 1.2e-02
lung cancer -1.600 3.8e-02
malignant mesothelioma 1.300 1.8e-05
medulloblastoma, large-cell -3.000 2.5e-07
Multiple myeloma 1.109 1.2e-02
oligodendroglioma -1.800 1.6e-02
ovarian cancer -1.400 6.7e-04
primitive neuroectodermal tumor -1.600 3.6e-03
spina bifida -1.228 3.7e-02
subependymal giant cell astrocytoma -1.257 3.0e-02
tuberculosis -1.100 3.0e-04

Gene RIF (65)

AA Sequence

MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHG      1 - 70
EKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVY     71 - 140
NLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFL    141 - 210
EMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEME    211 - 280
NSGLVHMLKNGKTEDLGCMYKLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKS    281 - 350
RFDRFLLESFNNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFR    351 - 420
FMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQH    421 - 490
LQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLN    491 - 560
ATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRA    561 - 630
LQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRK    631 - 700
HEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA      701 - 768
//

Text Mined References (130)

PMID Year Title