Property Summary

NCBI Gene PubMed Count 104
Grant Count 120
R01 Count 97
Funding $10,637,903.91
PubMed Score 1383.02
PubTator Score 134.16

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13618 A8K536 B8ZZC3 O75415 Q569L3 Q9UBI8 Q9UET7 CUL-3
Symbols CUL-3
PHA2E

Gene

PANTHER Protein Class (2)

PDB

2MYL   2MYM   4AP2   4APF   4EOZ   4HXI  

 GWAS Trait (1)

Gene RIF (59)

PMID Text
26687681 Study identifies a key role of Cul3-KLHL20 in autophagy termination by controlling autophagy-dependent turnover of ULK1 and VPS34 complex subunits and reveals the pathophysiological functions of this autophagy termination mechanism.
26544623 Data show that Cullin3 exerts its function through promoting breast-cancer metastasis suppressor 1 (BRMS1) protein degradation, which was associated with epithelial-mesenchymal transition (EMT), migration and invasion.
26334369 The authors find that the KCTD proteins 5, 6, 9 and 17 bind to Cul3 with high affinity, while the KCTD proteins 1 and 16 do not have detectable binding.
26219975 Data show that the differentiation of LiSa-2 preadipocytes is associated with an increase of cullin-associated and neddylation-dissociated 1 (CAND1), COP9 signalosome (CSN), neddylated cullin 3 (Cul3) and the BTB protein Keap1.
26188516 The KCTD5/cullin3 complex stabilizes ZNF711 transcription factor.Formation of trimeric complexes of KCTD5/cullin3 with MCM7, ZNF711 and FAM193B.
26100637 Cul3 deletion mutations (associated with hypertension), impair ubiquitin ligase activity toward RhoA.
26021998 these results suggest an essential role for CUL3 in the invasion and migration of trophoblast cells, and dysregulation of its expression may be associated with the onset of pre-eclampsia
25995385 CUL3 acts as a tumor suppressor by regulating oxidative stress
25848797 these findings indicate that the designed stapled peptides can efficiently mimic protein-protein interactions and are potentially able to modulate fundamental biological processes involving Cul3.
25684205 Heterodimeric CUL3 proteinubiquitylates TIAM1.CUL3 regulates TIAM1 abundance and subsequent RAC1 signaling.
More...

AA Sequence

MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHG      1 - 70
EKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVY     71 - 140
NLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFL    141 - 210
EMSAEFFQMESQKFLAENSASVYIKKVEARINEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEME    211 - 280
NSGLVHMLKNGKTEDLGCMYKLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKS    281 - 350
RFDRFLLESFNNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFR    351 - 420
FMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQH    421 - 490
LQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLN    491 - 560
ATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRA    561 - 630
LQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRK    631 - 700
HEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA      701 - 768
//

Publication (114)

PMID Year Title
27565346 2016 Two Distinct Types of E3 Ligases Work in Unison to Regulate Substrate Ubiquitylation.
27561354 2016 Cullin3-KLHL15 ubiquitin ligase mediates CtIP protein turnover to fine-tune DNA-end resection.
26687681 2016 Cul3-KLHL20 Ubiquitin Ligase Governs the Turnover of ULK1 and VPS34 Complexes to Control Autophagy Termination.
26544623 2015 Cullin3 promotes breast cancer cells metastasis and epithelial-mesenchymal transition by targeting BRMS1 for degradation.
26334369 2016 Structural Insights into KCTD Protein Assembly and Cullin3 Recognition.
26219975 2015 CAND1 exchange factor promotes Keap1 integration into cullin 3-RING ubiquitin ligase during adipogenesis.
26188516 2015 Interactions of cullin3/KCTD5 complexes with both cytoplasmic and nuclear proteins: Evidence for a role in protein stabilization.
26100637 2015 Hypertension-causing Mutations in Cullin3 Protein Impair RhoA Protein Ubiquitination and Augment the Association with Substrate Adaptors.
26021998 2015 New insights into the function of Cullin 3 in trophoblast invasion and migration.
25995385 2015 Transposon Mutagenesis Screen Identifies Potential Lung Cancer Drivers and CUL3 as a Tumor Suppressor.
More...