Property Summary

NCBI Gene PubMed Count 48
Grant Count 52
R01 Count 39
Funding $4,533,876.91
PubMed Score 93.60
PubTator Score 94.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma -1.207 0.002
adrenocortical carcinoma 1.034 0.000
tuberculosis and treatment for 6 months 1.300 0.000
lung cancer -1.100 0.005
adult high grade glioma -1.200 0.004
ovarian cancer 1.200 0.005
pituitary cancer 1.100 0.001

Gene RIF (14)

PMID Text
25326537 Cullins are a family of NEDD8 targets important in the stabilization and degradation of proteins, such as hypoxia-inducible factor (HIF1A), via Cullin-2.
24453364 Nevertheless, the identification of the Cul2 box may allow prediction of Cullin specificity for all E4orf6-containing Adenoviridae.
22912744 a novel link between the oncoprotein PRAME and the conserved EKC complex
22537386 Study finds that UBXN7 over-expression converts CUL2 to its neddylated form and causes the accumulation of non-ubiquitylated HIF1alpha.
22190034 HIV-1 Vif is identified to have a physical interaction with Cullin 2 (CUL2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21822215 The authors applied protein-complex purification strategies and identified PRAME as a substrate recognition subunit of a Cullin2-based E3 ubiquitin ligase.
20078552 The data suggest that neither HIF1alpha nor CUL2 mutation may play a central role in HIF1alpha activation in gastric, colorectal, breast, lung and hepatocellular carcinomas, and acute leukemias.
20078552 Observational study of gene-disease association. (HuGE Navigator)
19760754 Observational study of gene-disease association. (HuGE Navigator)
18984674 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVR      1 - 70
HLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIG     71 - 140
ELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQEIFESP    141 - 210
FLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHA    211 - 280
ECHNIIRQEKKNDMANMYVLLRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKF    281 - 350
VQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRLTSFIT    351 - 420
VFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKF    421 - 490
NNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLC    491 - 560
TGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKE    561 - 630
DIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALI    631 - 700
QEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA                             701 - 745
//

Publication (57)

PMID Year Title
27565346 2016 Two Distinct Types of E3 Ligases Work in Unison to Regulate Substrate Ubiquitylation.
25326537 2015 Stabilization of HIF through inhibition of Cullin-2 neddylation is protective in mucosal inflammatory responses.
24453364 2014 Analysis of the Cullin binding sites of the E4orf6 proteins of human adenovirus E3 ubiquitin ligases.
24076655 2013 TRIAD1 and HHARI bind to and are activated by distinct neddylated Cullin-RING ligase complexes.
23563313 2013 CCDC22 deficiency in humans blunts activation of proinflammatory NF-?B signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23102700 2012 The Kelch repeat protein KLHDC10 regulates oxidative stress-induced ASK1 activation by suppressing PP5.
22912744 2012 The human EKC/KEOPS complex is recruited to Cullin2 ubiquitin ligases by the human tumour antigen PRAME.
22537386 2012 UBXN7 docks on neddylated cullin complexes using its UIM motif and causes HIF1? accumulation.
22286099 2012 The LIMD1 protein bridges an association between the prolyl hydroxylases and VHL to repress HIF-1 activity.
More...