Property Summary

NCBI Gene PubMed Count 54
PubMed Score 95.10
PubTator Score 94.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma 1.034 1.5e-04
adult high grade glioma -1.200 3.9e-03
lung cancer -1.100 4.8e-03
malignant mesothelioma 1.100 7.1e-05
osteosarcoma -1.207 2.1e-03
ovarian cancer 1.200 4.7e-03
pituitary cancer 1.100 8.0e-04
tuberculosis and treatment for 6 months 1.300 1.3e-04

Gene RIF (17)

AA Sequence

MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVR      1 - 70
HLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIG     71 - 140
ELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQEIFESP    141 - 210
FLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHA    211 - 280
ECHNIIRQEKKNDMANMYVLLRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKF    281 - 350
VQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRLTSFIT    351 - 420
VFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKF    421 - 490
NNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLC    491 - 560
TGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKE    561 - 630
DIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALI    631 - 700
QEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA                             701 - 745
//

Text Mined References (63)

PMID Year Title