Property Summary

NCBI Gene PubMed Count 131
Grant Count 94
R01 Count 63
Funding $6,737,606.61
PubMed Score 167.22
PubTator Score 160.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 2.000 0.000

Synonym

Accession Q13616 D3DWG3 O60719 Q08AL6 Q8IYW1 CUL-1
Symbols

Gene

PANTHER Protein Class (2)

PDB

1LDJ   1LDK   1U6G   3RTR   3TDU   3TDZ   4F52   4P5O  

Gene RIF (50)

PMID Text
26717892 Cul1 promoted mTORC1 activity and cap-dependent translation by enhancing the ubiquitination and degradation of DEPTOR. eIF4F suppression inhibited the promoting effect of Cul1 on melanoma cell proliferation.
26632597 Nedd8(Q40E) cannot induce the same structural effect on Cul1-Rbx1 as wild-type Nedd8.
26540345 Data show that melanoma antigen, family C, 2 protein (MAGE-C2) binds with RING-box protein 1 (Rbx1) and Cullin 1, and regulates cyclin E stability in melanoma cells.
26097587 High Cul1 expression predicts worse 5-year overall and disease-specific survival rates in HCC patients.
25973042 Cullin-1 has been deeply implicated in the pathogenesis and development of prostate cancer
25652886 Increased CUL1 expression in CRC cells significantly promoted cell migration and invasion abilities in vitro and peritoneal metastasis in vivo through inducing high expression of MMPs.
25488749 Integrative analysis of mutations and somatic copy-number alterations revealed frequent genetic alterations in BAP1, NF2, CDKN2A, and CUL1 in pleural mesothelioma.
25425648 We discuss how these results can explain the rapid association of Cdc34 and SCF.
25201578 Our data indicated that Cul1 expression significantly increased in human glioma, and it may be involved in proliferation, migration and invasion of glioma cells.
24819753 In papillary thyroid carcinoma, cytoplasmic expression of Cul1 was correlated with tumor occurrence, N stage and Cyclin D1 expression. Nuclear Cul1 expression was negatively correlated with tumor occurence.
More...

AA Sequence

MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPS      1 - 70
KSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYL     71 - 140
NRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVE    141 - 210
LGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLH    211 - 280
ESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLA    281 - 350
AIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE    351 - 420
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMIS    421 - 490
KLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELE    491 - 560
RSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQ    561 - 630
IKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTH    631 - 700
KNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKD    701 - 770
TYSYLA                                                                    771 - 776
//

Publication (150)

PMID Year Title
27565346 2016 Two Distinct Types of E3 Ligases Work in Unison to Regulate Substrate Ubiquitylation.
26717892 2016 Cul1 promotes melanoma cell proliferation by promoting DEPTOR degradation and enhancing cap-dependent translation.
26632597 2015 Gln40 deamidation blocks structural reconfiguration and activation of SCF ubiquitin ligase complex by Nedd8.
26540345 2015 Cancer-testis antigen MAGE-C2 binds Rbx1 and inhibits ubiquitin ligase-mediated turnover of cyclin E.
26097587 2015 Cullin1 is up-regulated and associated with poor patients' survival in hepatocellular carcinoma.
25973042 2015 Cullin-1 promotes cell proliferation via cell cycle regulation and is a novel in prostate cancer.
25704143 Cep68 can be regulated by Nek2 and SCF complex.
25652886 2015 Cullin1 is a novel prognostic marker and regulates the cell proliferation and metastasis in colorectal cancer.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25585578 2015 FBH1 influences DNA replication fork stability and homologous recombination through ubiquitylation of RAD51.
More...