Property Summary

NCBI Gene PubMed Count 39
PubMed Score 10.28
PubTator Score 17.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma 1.200 0.010
oligodendroglioma 1.300 0.004
psoriasis -1.200 0.007
osteosarcoma -1.995 0.000
astrocytoma 1.100 0.004
group 4 medulloblastoma 1.500 0.000
medulloblastoma, large-cell 1.100 0.001
spina bifida -1.366 0.048
acute myeloid leukemia 1.200 0.017
ovarian cancer -1.200 0.000

Synonym

Accession Q13615 A5PL26 A7MD32 Q9NYN5 Q9NYN6 Q9UDX6 Q9UEG3
Symbols ZFYVE10
FYVE-DSP1

Gene

Gene RIF (14)

PMID Text
26787466 Data suggest MTMR3 has multiple functions in regulation of autophagy; one mechanism appears to be direct interaction between MTMR3 and mTORC1 (MTOR, mLST8, raptor) which inhibits phosphorylation activity of mTORC1; MTMR3 is localized to Golgi apparatus.
26240347 the rs713875 IBD risk polymorphism increases MTMR3 expression, which modulates pattern recognition receptor (PRR)-induced outcomes, including increased induced caspase-1 activation
25659891 myotubularin-related protein 3 and myotubularin-related protein 4 may act as a bridge between CEP55 and polo-like kinase 1, ensuring proper CEP55 phosphorylation and regulating CEP55 recruitment to the midbody.
25215329 These results indicate that MTMR3 may play an important role in the progression of CRC and suggest that siRNA mediated silencing of MTMR3 could be an effective tool in CRC treatment.
25195900 cloning, expression, purification and crystallization of human myotubularin-related protein 3 encompassing the PH-GRAM and the phosphatase catalytic domain are reported
24943867 Our results suggest that the MTMR3 gene is shared between IgA nephropathy and lupus nephritis in the northern Chinese population, further highlighting the role of autophagy in systemic lupus erythematosus.
24840251 Data suggest MTMR3, PIKFYVE (phosphoinositide kinase FYVE), and their product phosphatidylinositol 5-phosphate are involved in activation of RAC1 (rho family small GTP binding protein); this process regulates migration/invasion of carcinoma/sarcoma.
23154468 Production of phosphatidylinositol 5-phosphate via PIKfyve and MTMR3 regulates cell migration.
20477815 Observational study of gene-disease association. (HuGE Navigator)
20059746 Autophagosome formation was triggered by the overexpression of a dominant-negative inactive mutant of Myotubularin-related phosphatase 3 (MTMR3).
More...

AA Sequence

MDEETRHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEFVGRAEDAIIALSNYRLHIKFKESLVN      1 - 70
VPLQLIESVECRDIFQLHLTCKDCKVIRCQFSTFEQCQEWLKRLNNAIRPPAKIEDLFSFAYHAWCMEVY     71 - 140
ASEKEQHGDLCRPGEHVTSRFKNEVERMGFDMNNAWRISNINEKYKLCGSYPQELIVPAWITDKELESVS    141 - 210
SFRSWKRIPAVIYRHQSNGAVIARCGQPEVSWWGWRNADDEHLVQSVAKACASDSRSSGSKLSTRNTSRD    211 - 280
FPNGGDLSDVEFDSSLSNASGAESLAIQPQKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGMA    281 - 350
NIHSIRRSFQSLRLLCTQMPDPGNWLSALESTKWLHHLSVLLKSALLVVHAVDQDQRPVLVHCSDGWDRT    351 - 420
PQIVALAKLLLDPYYRTIEGFQVLVEMEWLDFGHKFADRCGHGENSDDLNERCPVFLQWLDCVHQLQRQF    421 - 490
PCSFEFNEAFLVKLVQHTYSCLFGTFLCNNAKERGEKHTQERTCSVWSLLRAGNKAFKNLLYSSQSEAVL    491 - 560
YPVCHVRNLMLWSAVYLPCPSPTTPVDDSCAPYPAPGTSPDDPPLSRLPKTRSYDNLTTACDNTVPLASR    561 - 630
RCSDPSLNEKWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPGGAELSVAAGVAEGQMENILQEATKEE    631 - 700
SGVEEPAHRAGIEIQEGKEDPLLEKESRRKTPEASAIGLHQDPELGDAALRSHLDMSWPLFSQGISEQQS    701 - 770
GLSVLLSSLQVPPRGEDSLEVPVEQFRIEEIAEGREEAVLPIPVDAKVGYGTSQSCSLLPSQVPFETRGP    771 - 840
NVDSSTDMLVEDKVKSVSGPQGHHRSCLVNSGKDRLPQTMEPSPSETSLVERPQVGSVVHRTSLGSTLSL    841 - 910
TRSPCALPLAECKEGLVCNGAPETENRASEQPPGLSTLQMYPTPNGHCANGEAGRSKDSLSRQLSAMSCS    911 - 980
SAHLHSRNLHHKWLHSHSGRPSATSSPDQPSRSHLDDDGMSVYTDTIQQRLRQIESGHQQEVETLKKQVQ    981 - 1050
ELKSRLESQYLTSSLHFNGDFGDEVTSIPDSESNLDQNCLSRCSTEIFSEASWEQVDKQDTEMTRWLPDH   1051 - 1120
LAAHCYACDSAFWLASRKHHCRNCGNVFCSSCCNQKVPVPSQQLFEPSRVCKSCYSSLHPTSSSIDLELD   1121 - 1190
KPIAATSN                                                                 1191 - 1198
//

Publication (46)

PMID Year Title
26787466 2016 The PtdIns3-phosphatase MTMR3 interacts with mTORC1 and suppresses its activity.
26240347 2015 MTMR3 risk allele enhances innate receptor-induced signaling and cytokines by decreasing autophagy and increasing caspase-1 activation.
25659891 2015 Myotubularin-related proteins 3 and 4 interact with polo-like kinase 1 and centrosomal protein of 55 kDa to ensure proper abscission.
25578879 2015 PI(5)P regulates autophagosome biogenesis.
25215329 2014 Myotubularin-related phosphatase 3 promotes growth of colorectal cancer cells.
25195900 2014 Expression, purification, crystallization and preliminary crystallographic analysis of human myotubularin-related protein 3.
24943867 2014 Brief Report: identification of MTMR3 as a novel susceptibility gene for lupus nephritis in northern Han Chinese by shared-gene analysis with IgA nephropathy.
24840251 2014 PIKfyve, MTMR3 and their product PtdIns5P regulate cancer cell migration and invasion through activation of Rac1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
More...