Property Summary

NCBI Gene PubMed Count 36
PubMed Score 46.48
PubTator Score 44.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 3.300 2.5e-02
ependymoma -1.100 8.9e-03
lung cancer 2.800 5.0e-04
ovarian cancer 1.800 7.1e-04
psoriasis -1.700 4.5e-05

Protein-protein Interaction (1)

Gene RIF (19)

AA Sequence

MEKSSSCESLGSQPAAARPPSVDSLSSASTSHSENSVHTKSASVVSSDSISTSADNFSPDLRVLRESNKL      1 - 70
AEMEEPPLLPGENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYFKSMERDPPFVLDASLGVINRVEKIGG     71 - 140
ASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPLFAFEYKEVFPENGWKLYD    141 - 210
PLLEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQAT    211 - 280
ITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVF    281 - 350
LDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDG    351 - 420
WDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFIDCVWQM    421 - 490
TRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSLWSYINSQLEDFTNPLYGSYS    491 - 560
NHVLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISNRSTSSSERAS    561 - 630
SPAQCVTPVQTVV                                                             631 - 643
//

Text Mined References (41)

PMID Year Title