Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.93
PubTator Score 6.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.175 3.0e-05
adrenocortical carcinoma 1.064 1.7e-02
aldosterone-producing adenoma -1.376 1.5e-02
atypical teratoid / rhabdoid tumor 1.200 2.2e-02
dermatomyositis 1.300 1.3e-04
Gaucher disease type 1 -2.100 4.9e-03
group 4 medulloblastoma 1.500 9.4e-03
lung cancer 1.600 9.2e-03
medulloblastoma, large-cell 1.500 3.5e-04
non primary Sjogren syndrome sicca -1.500 1.6e-02
oligodendroglioma 1.100 5.3e-03
osteosarcoma -2.755 7.9e-07
ovarian cancer -1.100 9.0e-04
Pick disease -1.400 1.4e-04
psoriasis 1.300 1.3e-03
spina bifida -1.256 4.6e-02

Gene RIF (3)

AA Sequence

MDRPAAAAAAGCEGGGGPNPGPAGGRRPPRAAGGATAGSRQPSVETLDSPTGSHVEWCKQLIAATISSQI      1 - 70
SGSVTSENVSRDYKALRDGNKLAQMEEAPLFPGESIKAIVKDVMYICPFMGAVSGTLTVTDFKLYFKNVE     71 - 140
RDPHFILDVPLGVISRVEKIGAQSHGDNSCGIEIVCKDMRNLRLAYKQEEQSKLGIFENLNKHAFPLSNG    141 - 210
QALFAFSYKEKFPINGWKVYDPVSEYKRQGLPNESWKISKINSNYEFCDTYPAIIVVPTSVKDDDLSKVA    211 - 280
AFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVADT    281 - 350
NKTKGGGYESESAYPNAELVFLEIHNIHVMRESLRKLKEIVYPSIDEARWLSNVDGTHWLEYIRMLLAGA    351 - 420
VRIADKIESGKTSVVVHCSDGWDRTAQLTSLAMLMLDSYYRTIKGFETLVEKEWISFGHRFALRVGHGND    421 - 490
NHADADRSPIFLQFVDCVWQMTRQFPSAFEFNELFLITILDHLYSCLFGTFLCNCEQQRFKEDVYTKTIS    491 - 560
LWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNYYVRWNPRMRPQMPIHQNLKELLAVRAELQK    561 - 630
RVEGLQREVATRAVSSSSERGSSPSHSATSVHTSV                                       631 - 665
//

Text Mined References (20)

PMID Year Title