Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.33
PubTator Score 3.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.169 0.001
Multiple myeloma 1.328 0.003
psoriasis 2.500 0.000
osteosarcoma 3.166 0.000
lung cancer 2.100 0.001
group 3 medulloblastoma 1.200 0.005
ovarian cancer 3.100 0.000
dermatomyositis 1.500 0.001

Synonym

Accession Q13610 A8K3R6 Q7Z3X9
Symbols IEF-SSP-9502

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
20028516 Endonuclein interacts with several proteins indicating a broad function including signal transduction and chaperone activity

AA Sequence

MNRSRQVTCVAWVRCGVAKETPDKVELSKEEVKRLIAEAKEKLQEEGGGSDEEETGSPSEDGMQSARTQA      1 - 70
RPREPLEDGDPEDDRTLDDDELAEYDLDKYDEEGDPDAETLGESLLGLTVYGSNDQDPYVTLKDTEQYER     71 - 140
EDFLIKPSDNLIVCGRAEQDQCNLEVHVYNQEEDSFYVHHDILLSAYPLSVEWLNFDPSPDDSTGNYIAV    141 - 210
GNMTPVIEVWDLDIVDSLEPVFTLGSKLSKKKKKKGKKSSSAEGHTDAVLDLSWNKLIRNVLASASADNT    211 - 280
VILWDMSLGKPAASLAVHTDKVQTLQFHPFEAQTLISGSYDKSVALYDCRSPDESHRMWRFSGQIERVTW    281 - 350
NHFSPCHFLASTDDGFVYNLDARSDKPIFTLNAHNDEISGLDLSSQIKGCLVTASADKYVKIWDILGDRP    351 - 420
SLVHSRDMKMGVLFCSSCCPDLPFIYAFGGQKEGLRVWDISTVSSVNEAFGRRERLVLGSARNSSISGPF    421 - 490
GSRSSDTPMES                                                               491 - 501
//

Publication (23)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20028516 2009 Identification and characterization of endonuclein binding proteins: evidence of modulatory effects on signal transduction and chaperone activity.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
More...