Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.04
PubTator Score 3.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.7e-08
psoriasis 6694 1.7e-05
lung cancer 4740 5.1e-04
dermatomyositis 966 7.3e-04
ovarian cancer 8520 7.9e-04
Waldenstrons macroglobulinemia 765 1.2e-03
Multiple myeloma 1332 2.8e-03
group 3 medulloblastoma 4104 4.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Cardiac tamponade 4 3.567 1.8

Expression

  Differential Expression (8)

Disease log2 FC p
dermatomyositis 1.500 7.3e-04
group 3 medulloblastoma 1.200 4.9e-03
lung cancer 2.100 5.1e-04
Multiple myeloma 1.328 2.8e-03
osteosarcoma 3.166 1.7e-08
ovarian cancer -1.100 7.9e-04
psoriasis 2.500 1.7e-05
Waldenstrons macroglobulinemia 1.169 1.2e-03

Synonym

Accession Q13610 A8K3R6 Q7Z3X9
Symbols IEF-SSP-9502

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MNRSRQVTCVAWVRCGVAKETPDKVELSKEEVKRLIAEAKEKLQEEGGGSDEEETGSPSEDGMQSARTQA      1 - 70
RPREPLEDGDPEDDRTLDDDELAEYDLDKYDEEGDPDAETLGESLLGLTVYGSNDQDPYVTLKDTEQYER     71 - 140
EDFLIKPSDNLIVCGRAEQDQCNLEVHVYNQEEDSFYVHHDILLSAYPLSVEWLNFDPSPDDSTGNYIAV    141 - 210
GNMTPVIEVWDLDIVDSLEPVFTLGSKLSKKKKKKGKKSSSAEGHTDAVLDLSWNKLIRNVLASASADNT    211 - 280
VILWDMSLGKPAASLAVHTDKVQTLQFHPFEAQTLISGSYDKSVALYDCRSPDESHRMWRFSGQIERVTW    281 - 350
NHFSPCHFLASTDDGFVYNLDARSDKPIFTLNAHNDEISGLDLSSQIKGCLVTASADKYVKIWDILGDRP    351 - 420
SLVHSRDMKMGVLFCSSCCPDLPFIYAFGGQKEGLRVWDISTVSSVNEAFGRRERLVLGSARNSSISGPF    421 - 490
GSRSSDTPMES                                                               491 - 501
//

Text Mined References (24)

PMID Year Title