Property Summary

NCBI Gene PubMed Count 27
PubMed Score 203.58
PubTator Score 47.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung cancer 2798 6.34791160462744E-20
lung adenocarcinoma 2714 8.23026019951834E-14
psoriasis 6685 4.93028459246577E-13
osteosarcoma 7933 2.1192769555177E-9
adrenocortical carcinoma 1427 3.29447727470245E-7
medulloblastoma, large-cell 6234 3.05765915586442E-5
non-inflammatory breast cancer 208 3.94928001766677E-5
colon cancer 1475 7.47809463083844E-5
ulcerative colitis 2087 1.46455396216755E-4
breast carcinoma 1614 2.89002511404607E-4
lung cancer 4473 3.68885801547311E-4
primary Sjogren syndrome 789 8.60013335218873E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00105397104332332
nasopharyngeal carcinoma 1056 0.00115933810706954
pituitary cancer 1972 0.00178308229755927
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0020013880241752
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00233194930320975
invasive ductal carcinoma 2950 0.00255643375339634
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00402201095649367
interstitial cystitis 2299 0.00429984316409565
head and neck cancer 270 0.00431377449783433
aldosterone-producing adenoma 664 0.0304933427891144

Expression

Synonym

Accession Q13609 B2R8B1 B7Z707 O75803 DNase gamma
Symbols LSD
DHP2
SLEB16
DNAS1L3

Gene

  Ortholog (7)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 MGI Term (1)

Pathway (1)

Gene RIF (15)

PMID Text
25332064 Data indicate a likely functional variant influencing scleroderma susceptibility at deoxyribonuclease I-like 3 protein DNASE1L3 missense polymorphism rs35677470.
24206041 Single nucleotide polymorphisms in the DNASE1L3 is associated with autoimmune diseases.
23666765 DNASE1L3 mutations occur in hypocomplementemic urticarial vasculitis syndrome.
23229555 These results suggest a cooperative activity between CAD and DNAS1L3 to accomplish internucleosomal DNA fragmentation .
22019780 We identified a rare autosomal recessive form of systemic lupus erythematosus, in which autozygome analysis revealed a null mutation in the DNASE1L3 gene
21692081 investigates the distribution of DNASE1L3 gene SNPs in exons of the gene in eight Asian, three African, and three Caucasian populations worldwide using newly devised genotyping methods.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19574717 Results distinguish DNase gamma-dependent and CAD/DFF40-dependent DNA fragmentations, and show that even if DNA fragmentation is initiated by CAD/DFF40, DNase gamma is required for the more complete digestion of the genomic DNA in dying cells.
19559017 A Caucasian-specific allele in SNP R206C produces an inactive form of DNase Il3.
More...

AA Sequence

MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPI      1 - 70
LMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQ     71 - 140
SPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTD    141 - 210
PRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFK    211 - 280
LQSSRAFTNSKKSVTLRKKTKSKRS                                                 281 - 305
//

Text Mined References (32)

PMID Year Title
27293190 2016 Digestion of Chromatin in Apoptotic Cell Microparticles Prevents Autoimmunity.
25332064 2014 An Immunochip-based interrogation of scleroderma susceptibility variants identifies a novel association at DNASE1L3.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24312463 2013 DNase ? is the effector endonuclease for internucleosomal DNA fragmentation in necrosis.
24206041 2014 Evaluation of all non-synonymous single nucleotide polymorphisms (SNPs) in the genes encoding human deoxyribonuclease I and I-like 3 as a functional SNP potentially implicated in autoimmunity.
23666765 2013 DNASE1L3 mutations in hypocomplementemic urticarial vasculitis syndrome.
23568457 2013 Genetic variants associated with disordered eating.
23229555 2013 Apoptotic DNA fragmentation may be a cooperative activity between caspase-activated deoxyribonuclease and the poly(ADP-ribose) polymerase-regulated DNAS1L3, an endoplasmic reticulum-localized endonuclease that translocates to the nucleus during apoptosis.
22019780 2011 Loss-of-function variant in DNASE1L3 causes a familial form of systemic lupus erythematosus.
21692081 2011 Global genetic analysis of all single nucleotide polymorphisms in exons of the human deoxyribonuclease I-like 3 gene and their effect on its catalytic activity.
More...