Property Summary

NCBI Gene PubMed Count 29
PubMed Score 207.28
PubTator Score 47.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -2.992 3.3e-07
aldosterone-producing adenoma -1.145 3.0e-02
breast carcinoma -1.800 2.9e-04
colon cancer -1.800 7.5e-05
head and neck cancer -1.300 4.3e-03
interstitial cystitis 1.500 4.3e-03
intraductal papillary-mucinous adenoma (... -1.400 2.3e-03
intraductal papillary-mucinous carcinoma... -1.500 1.1e-03
intraductal papillary-mucinous neoplasm ... -1.700 4.0e-03
invasive ductal carcinoma -1.600 2.6e-03
lung adenocarcinoma -2.400 8.2e-14
lung cancer -2.600 3.7e-04
medulloblastoma, large-cell 1.400 3.1e-05
nasopharyngeal carcinoma -1.400 1.2e-03
non-inflammatory breast cancer -1.100 3.9e-05
non-small cell lung cancer -2.716 6.3e-20
osteosarcoma -4.614 8.4e-13
pancreatic ductal adenocarcinoma liver m... -3.293 2.0e-03
pituitary cancer -1.300 1.8e-03
primary Sjogren syndrome 1.500 8.6e-04
psoriasis 1.500 2.1e-31
ulcerative colitis 1.300 1.5e-04

Gene RIF (16)

AA Sequence

MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPI      1 - 70
LMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQ     71 - 140
SPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTD    141 - 210
PRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFK    211 - 280
LQSSRAFTNSKKSVTLRKKTKSKRS                                                 281 - 305
//

Text Mined References (34)

PMID Year Title