Property Summary

NCBI Gene PubMed Count 27
Grant Count 3
Funding $207,008.83
PubMed Score 75.34
PubTator Score 43.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -2.000 0.000
medulloblastoma, large-cell -1.200 0.000
cystic fibrosis 2.000 0.000
lung adenocarcinoma 1.100 0.000
ovarian cancer 1.100 0.003

Synonym

Accession Q13608 Q5T8W1 Q8WYQ0 Q8WYQ1 Q8WYQ2 Q99476 PAF-2
Symbols PAF2
HMLR2
PAF-2
PBD4A
PDB4B
PXAAA1

Gene

Gene RIF (11)

PMID Text
26593283 PEX6 is expressed in photoreceptor cilia and mutated in deafblindness with enamel dysplasia and microcephaly.
26476099 Our structural data suggest that the tilting of a central segment of a Pex1-Pex6 pair is responsible for polypeptide movement.
26387595 Mutations in PEX6 gene is associated with Heimler Syndrome.
25016021 results suggested that peroxisome biogenesis requires Pex1p- and Pex6p-regulated dissociation of Pex14p from Pex26p
22894767 increased incidence of Zellweger syndrome in French-Canadians of Lac-St-Jean region caused by a PEX6 founder mutation
21778671 hybrid exercise increases expression of eukaryotic translation initiation factor 5A (EIFSA), peroxisomal biogenesis factor 6 (PEX6) and histone cluster 1 H4 (HIST1H4), compared with electrical stimulation alone
19877282 We identified a total of 77 different mutations in Zellweger syndrome patients of which 47 mutations have not been reported previously, and 14 polymorphic variants.
19433277 Leigh syndrome presenting the T8993G mutation in the ATPase 6 gene with variable heteroplasmic loads (44-98%) in a single Tunisian family is a novel finding.
19105186 the relative fraction of disease-causing alleles that occur in the coding and splice junction sequences of PEX6 gene.
16257970 Insufficient binding to Pex1p x Pex6p complexes, or mislocalization of patient-derived Pex26p mutants is most likely responsible for the complementation group impaired peroxisome biogenesis.
More...

AA Sequence

MALAVLRVLEPFPTETPPLAVLLPPGGPWPAAELGLVLALRPAGESPAGPALLVAALEGPDAGTEEQGPG      1 - 70
PPQLLVSRALLRLLALGSGAWVRARAVRRPPALGWALLGTSLGPGLGPRVGPLLVRRGETLPVPGPRVLE     71 - 140
TRPALQGLLGPGTRLAVTELRGRARLCPESGDSSRPPPPPVVSSFAVSGTVRRLQGVLGGTGDSLGVSRS    141 - 210
CLRGLGLFQGEWVWVAQARESSNTSQPHLARVQVLEPRWDLSDRLGPGSGPLGEPLADGLALVPATLAFN    211 - 280
LGCDPLEMGELRIQRYLEGSIAPEDKGSCSLLPGPPFARELHIEIVSSPHYSTNGNYDGVLYRHFQIPRV    281 - 350
VQEGDVLCVPTIGQVEILEGSPEKLPRWREMFFKVKKTVGEAPDGPASAYLADTTHTSLYMVGSTLSPVP    351 - 420
WLPSEESTLWSSLSPPGLEALVSELCAVLKPRLQPGGALLTGTSSVLLRGPPGCGKTTVVAAACSHLGLH    421 - 490
LLKVPCSSLCAESSGAVETKLQAIFSRARRCRPAVLLLTAVDLLGRDRDGLGEDARVMAVLRHLLLNEDP    491 - 560
LNSCPPLMVVATTSRAQDLPADVQTAFPHELEVPALSEGQRLSILRALTAHLPLGQEVNLAQLARRCAGF    561 - 630
VVGDLYALLTHSSRAACTRIKNSGLAGGLTEEDEGELCAAGFPLLAEDFGQALEQLQTAHSQAVGAPKIP    631 - 700
SVSWHDVGGLQEVKKEILETIQLPLEHPELLSLGLRRSGLLLHGPPGTGKTLLAKAVATECSLTFLSVKG    701 - 770
PELINMYVGQSEENVREVFARARAAAPCIIFFDELDSLAPSRGRSGDSGGVMDRVVSQLLAELDGLHSTQ    771 - 840
DVFVIGATNRPDLLDPALLRPGRFDKLVFVGANEDRASQLRVLSAITRKFKLEPSVSLVNVLDCCPPQLT    841 - 910
GADLYSLCSDAMTAALKRRVHDLEEGLEPGSSALMLTMEDLLQAAARLQPSVSEQELLRYKRIQRKFAAC    911 - 980
//

Text Mined References (30)

PMID Year Title
26593283 2016 PEX6 is Expressed in Photoreceptor Cilia and Mutated in Deafblindness with Enamel Dysplasia and Microcephaly.
26476099 2016 Structures of the double-ring AAA ATPase Pex1-Pex6 involved in peroxisome biogenesis.
26387595 2015 Heimler Syndrome Is Caused by Hypomorphic Mutations in the Peroxisome-Biogenesis Genes PEX1 and PEX6.
25016021 2014 AAA peroxins and their recruiter Pex26p modulate the interactions of peroxins involved in peroxisomal protein import.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
22894767 2012 A founder mutation in the PEX6 gene is responsible for increased incidence of Zellweger syndrome in a French Canadian population.
21980954 2012 AWP1/ZFAND6 functions in Pex5 export by interacting with cys-monoubiquitinated Pex5 and Pex6 AAA ATPase.
21937992 2011 Deep sequencing reveals 50 novel genes for recessive cognitive disorders.
21778671 2011 "Hybrid exercise" prevents muscle atrophy in association with a distinct gene expression pattern.
19877282 2010 Spectrum of PEX6 mutations in Zellweger syndrome spectrum patients.
More...