Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.06
PubTator Score 2.38

Knowledge Summary

Patent (755)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
lung cancer 4740 0.0 0.6
Disease Target Count Z-score Confidence
Hepatoblastoma 19 3.457 1.7

AA Sequence

MEFTDRNYTLVTEFILLGFPTRPELQIVLFLMFLTLYAIILIGNIGLMLLIRIDPHLQTPMYFFLSNLSF      1 - 70
VDLCYFSDIVPKMLVNFLSENKSISYYGCALQFYFFCTFADTESFILAAMAYDRYVAICNPLLYTVVMSR     71 - 140
GICMRLIVLSYLGGNMSSLVHTSFAFILKYCDKNVINHFFCDLPPLLKLSCTDTTINEWLLSTYGSSVEI    141 - 210
ICFIIIIISYFFILLSVLKIRSFSGRKKTFSTCASHLTSVTIYQGTLLFIYSRPSYLYSPNTDKIISVFY    211 - 280
TIFIPVLNPLIYSLRNKDVKDAAEKVLRSKVDSS                                        281 - 314
//

Text Mined References (5)

PMID Year Title