Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.06
PubTator Score 2.38

Knowledge Summary

Patent (755)

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Hepatoblastoma 17 3.453 1.7

Synonym

Accession Q13606 Q6IEU4
Symbols OLF1
HSOlf1

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA Inparanoid
Opossum OMA Inparanoid

AA Sequence

MEFTDRNYTLVTEFILLGFPTRPELQIVLFLMFLTLYAIILIGNIGLMLLIRIDPHLQTPMYFFLSNLSF      1 - 70
VDLCYFSDIVPKMLVNFLSENKSISYYGCALQFYFFCTFADTESFILAAMAYDRYVAICNPLLYTVVMSR     71 - 140
GICMRLIVLSYLGGNMSSLVHTSFAFILKYCDKNVINHFFCDLPPLLKLSCTDTTINEWLLSTYGSSVEI    141 - 210
ICFIIIIISYFFILLSVLKIRSFSGRKKTFSTCASHLTSVTIYQGTLLFIYSRPSYLYSPNTDKIISVFY    211 - 280
TIFIPVLNPLIYSLRNKDVKDAAEKVLRSKVDSS                                        281 - 314
//

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9787077 1998 Organization and evolution of olfactory receptor genes on human chromosome 11.
9017400 1997 The evolution of mammalian olfactory receptor genes.