Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.06
PubTator Score 2.38

Knowledge Summary

Patent (755)


  Disease Relevance (1)

Disease Z-score Confidence
Hepatoblastoma 17 3.453 1.7

AA Sequence

TIFIPVLNPLIYSLRNKDVKDAAEKVLRSKVDSS                                        281 - 314

Publication (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9787077 1998 Organization and evolution of olfactory receptor genes on human chromosome 11.
9017400 1997 The evolution of mammalian olfactory receptor genes.