Property Summary

NCBI Gene PubMed Count 23
PubMed Score 9.40
PubTator Score 4.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.200 0.000
osteosarcoma 1.652 0.000
glioblastoma 1.200 0.010
medulloblastoma, large-cell 1.300 0.000
primitive neuroectodermal tumor 1.300 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.021
lung cancer 1.100 0.004
active Crohn's disease 1.037 0.007
pediatric high grade glioma 1.400 0.000
ovarian cancer 1.900 0.000

Synonym

Accession Q13601 A0FIK6 A0JLP0 B2R989 E7EUQ0 Q8NEA8 Q8TC37 Q96AT5
Symbols HRB2
RIP-1

Gene

 GO Function (1)

Gene RIF (10)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22944692 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21358275 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15832179 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
7505766 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREA      1 - 70
YLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDV     71 - 140
ACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVVLDTM    141 - 210
KNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDK    211 - 280
ELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKV    281 - 350
KKAKNKKLGALTAEEIALKMEADEKKKKKKK                                           351 - 381
//

Publication (30)

PMID Year Title
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...