Property Summary

NCBI Gene PubMed Count 23
PubMed Score 9.40
PubTator Score 4.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
pediatric high grade glioma 2712 3.79498326579009E-6
ovarian cancer 8492 4.7626527881191E-6
osteosarcoma 7933 7.79733958534821E-6
medulloblastoma, large-cell 6234 3.41675619675333E-5
primitive neuroectodermal tumor 3031 2.55784657861374E-4
psoriasis 6685 4.85257305781605E-4
lung cancer 4473 0.0036720566637237
active Crohn's disease 918 0.00663364047518914
glioblastoma 5572 0.0103982890773854
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0214448160256703
Disease Target Count Z-score Confidence
Polycystic Ovary Syndrome 335 3.333 1.7

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.200 0.000
osteosarcoma 1.652 0.000
glioblastoma 1.200 0.010
medulloblastoma, large-cell 1.300 0.000
primitive neuroectodermal tumor 1.300 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.021
lung cancer 1.100 0.004
active Crohn's disease 1.037 0.007
pediatric high grade glioma 1.400 0.000
ovarian cancer 1.900 0.000

Synonym

Accession Q13601 A0FIK6 A0JLP0 B2R989 E7EUQ0 Q8NEA8 Q8TC37 Q96AT5
Symbols HRB2
RIP-1

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 GO Function (1)

Gene RIF (7)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22944692 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21358275 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15832179 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
7505766 Tandem affinity purification and mass spectrometry analysis identify HIV-1 Rev binding protein 2 (KRR1; RIP-1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREA      1 - 70
YLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDV     71 - 140
ACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVVLDTM    141 - 210
KNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDK    211 - 280
ELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKV    281 - 350
KKAKNKKLGALTAEEIALKMEADEKKKKKKK                                           351 - 381
//

Text Mined References (30)

PMID Year Title
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...