Property Summary

NCBI Gene PubMed Count 24
PubMed Score 9.98
PubTator Score 4.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease 1.037 6.6e-03
glioblastoma 1.200 1.0e-02
intraductal papillary-mucinous adenoma (... 1.200 2.1e-02
lung cancer 1.100 3.7e-03
medulloblastoma, large-cell 1.300 3.4e-05
osteosarcoma 1.652 7.8e-06
ovarian cancer -1.300 2.0e-06
pediatric high grade glioma 1.400 3.8e-06
primitive neuroectodermal tumor 1.300 2.6e-04
psoriasis -1.200 4.9e-04

 GO Function (1)

Gene RIF (8)

AA Sequence

MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREA      1 - 70
YLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDV     71 - 140
ACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVVLDTM    141 - 210
KNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDK    211 - 280
ELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKV    281 - 350
KKAKNKKLGALTAEEIALKMEADEKKKKKKK                                           351 - 381
//

Text Mined References (32)

PMID Year Title