Property Summary

NCBI Gene PubMed Count 51
PubMed Score 43.70
PubTator Score 44.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Astrocytoma, Pilocytic 1.500 6.7e-08
atypical teratoid / rhabdoid tumor 1.200 9.8e-06
Breast cancer -1.200 7.0e-09
breast carcinoma -1.500 4.4e-34
diabetes mellitus -1.400 1.2e-03
ductal carcinoma in situ -1.500 6.9e-05
glioblastoma 1.200 2.7e-05
invasive ductal carcinoma -2.300 2.0e-04
lung adenocarcinoma -1.040 4.0e-05
lung cancer -1.500 4.0e-03
non-small cell lung cancer -1.444 1.6e-20
osteosarcoma -1.647 2.8e-03
ovarian cancer -3.200 1.9e-12
psoriasis -1.600 3.1e-09
tuberculosis and treatment for 6 months -1.100 9.8e-04

Protein-protein Interaction (6)

Gene RIF (22)

AA Sequence

MASGGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPKITTSLLPINN      1 - 70
GSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYEELEEEEQE     71 - 140
DQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPP    141 - 210
PPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLS    211 - 280
GAGLLKMFNKATDAVSKMTIKMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKS    281 - 350
LAMLGSSEDNTALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRW    351 - 420
QDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWESRVTQYERDFERISTVVRKEVIRFEKEKSKDFK    421 - 490
NHVIKYLETLLYSQQQLAKYWEAFLPEAKAIS                                          491 - 522
//

Text Mined References (65)

PMID Year Title