Property Summary

NCBI Gene PubMed Count 48
Grant Count 44
R01 Count 15
Funding $2,989,687.58
PubMed Score 41.02
PubTator Score 44.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -1.647 0.003
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.200 0.000
tuberculosis and treatment for 6 months -1.100 0.001
non-small cell lung cancer -1.444 0.000
lung cancer -1.900 0.001
diabetes mellitus -1.400 0.001
pilocytic astrocytoma 1.500 0.000
lung adenocarcinoma -1.040 0.000
breast carcinoma -1.500 0.000
Breast cancer -1.200 0.000
ductal carcinoma in situ -1.500 0.000
invasive ductal carcinoma -2.300 0.000
ovarian cancer -3.200 0.000

Gene RIF (21)

PMID Text
25653196 Results show that suppression of EGFR membrane recycling by SNX1 appears to be critical for the activation of EGFR /PI3K/AKT signaling pathway in human lung cancer cells.
24835695 miR-95 functions as an oncogene role in non-small cell lung cancer cells by directly targeting SNX1.
23152498 SNX1 has a crucial role in D(5)R trafficking and SNX1 depletion results in D(5)R dysfunction and thus may represent a novel mechanism for the pathogenesis of essential hypertension
22859339 we suggest that SNX1 is involved in the negative regulation of ligand-induced EGFR phosphorylation and mediates EGFR/pEGFR trafficking out of early endosomes
22673115 This study found that significant evidence of association with SNX1 (VEGAS p = 0.035) in patient with Alzheimer disease.
21973056 SNX4, but not SNX1 and SNX8, is associated with the Rab11-recycling endosomes and that a high frequency of SNX4-mediated tubule formation is observed as endosomes undergo Rab4-to-Rab11 transition.
21427358 Results demonstrate that miR-95 increases proliferation by directly targeting SNX1, defining miR-95 as a new oncogenic miRNA in CRC.
20604901 SNX1 and SNX2 interact with Kalirin-7. Overexpression of SNX1 or SNX2 and Kalirin-7 partially redistributes both SNXs to the plasma membrane, and results in RhoG-dependent lamellipodia formation.
20070609 These data describe a novel function of SNX1 in the regulation of P2Y(1) receptor recycling and suggest that SNX1 plays multiple roles in endocytic trafficking of G-protein coupled receptors.
18088323 sortilin and mannose-6-phosphate receptors recycle to the TGN in SNX1-dependent carriers, which we named endosome-to-TGN transport carriers
More...

AA Sequence

MASGGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPKITTSLLPINN      1 - 70
GSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYEELEEEEQE     71 - 140
DQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPP    141 - 210
PPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLS    211 - 280
GAGLLKMFNKATDAVSKMTIKMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKS    281 - 350
LAMLGSSEDNTALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRW    351 - 420
QDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWESRVTQYERDFERISTVVRKEVIRFEKEKSKDFK    421 - 490
NHVIKYLETLLYSQQQLAKYWEAFLPEAKAIS                                          491 - 522
//

Text Mined References (62)

PMID Year Title
26220253 2015 Retromer: Structure, function, and roles in mammalian disease.
25653196 2015 EGF?stimulated AKT activation is mediated by EGFR recycling via an early endocytic pathway in a gefitinib?resistant human lung cancer cell line.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24835695 2014 MiR-95 induces proliferation and chemo- or radioresistance through directly targeting sorting nexin1 (SNX1) in non-small cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152498 2013 Sorting nexin 1 loss results in D5 dopamine receptor dysfunction in human renal proximal tubule cells and hypertension in mice.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
22859339 2012 Silencing of SNX1 by siRNA stimulates the ligand-induced endocytosis of EGFR and increases EGFR phosphorylation in gefitinib-resistant human lung cancer cell lines.
More...