Property Summary

NCBI Gene PubMed Count 48
PubMed Score 41.02
PubTator Score 44.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 4.44625955537745E-34
non-small cell lung cancer 2798 1.63957161217292E-20
ovarian cancer 8492 1.88328125942439E-12
psoriasis 6685 3.11888002300413E-9
Breast cancer 3099 6.99168933332434E-9
pilocytic astrocytoma 3086 2.17213250328275E-8
atypical teratoid / rhabdoid tumor 4369 9.81302752067799E-6
glioblastoma 5572 2.65413357896665E-5
lung adenocarcinoma 2714 4.04808388546723E-5
ductal carcinoma in situ 1745 6.86240254224796E-5
invasive ductal carcinoma 2950 2.0028470008348E-4
lung cancer 4473 9.69317301134033E-4
tuberculosis and treatment for 6 months 686 9.79753289038929E-4
diabetes mellitus 1663 0.00119395946551149
osteosarcoma 7933 0.00279571340215551
Disease Target Count Z-score Confidence
Obstructive hydrocephalus 2 3.09 1.5

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -1.647 0.003
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.200 0.000
tuberculosis and treatment for 6 months -1.100 0.001
non-small cell lung cancer -1.444 0.000
lung cancer -1.900 0.001
diabetes mellitus -1.400 0.001
pilocytic astrocytoma 1.500 0.000
lung adenocarcinoma -1.040 0.000
breast carcinoma -1.500 0.000
Breast cancer -1.200 0.000
ductal carcinoma in situ -1.500 0.000
invasive ductal carcinoma -2.300 0.000
ovarian cancer -3.200 0.000

Synonym

Accession Q13596 A6NM19 A8K6T7 H0Y2M5 O60750 O60751 Q6ZRJ8
Symbols VPS5
HsT17379

Gene

PDB

2I4K   4FZS  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (21)

PMID Text
25653196 Results show that suppression of EGFR membrane recycling by SNX1 appears to be critical for the activation of EGFR /PI3K/AKT signaling pathway in human lung cancer cells.
24835695 miR-95 functions as an oncogene role in non-small cell lung cancer cells by directly targeting SNX1.
23152498 SNX1 has a crucial role in D(5)R trafficking and SNX1 depletion results in D(5)R dysfunction and thus may represent a novel mechanism for the pathogenesis of essential hypertension
22859339 we suggest that SNX1 is involved in the negative regulation of ligand-induced EGFR phosphorylation and mediates EGFR/pEGFR trafficking out of early endosomes
22673115 This study found that significant evidence of association with SNX1 (VEGAS p = 0.035) in patient with Alzheimer disease.
21973056 SNX4, but not SNX1 and SNX8, is associated with the Rab11-recycling endosomes and that a high frequency of SNX4-mediated tubule formation is observed as endosomes undergo Rab4-to-Rab11 transition.
21427358 Results demonstrate that miR-95 increases proliferation by directly targeting SNX1, defining miR-95 as a new oncogenic miRNA in CRC.
20604901 SNX1 and SNX2 interact with Kalirin-7. Overexpression of SNX1 or SNX2 and Kalirin-7 partially redistributes both SNXs to the plasma membrane, and results in RhoG-dependent lamellipodia formation.
20070609 These data describe a novel function of SNX1 in the regulation of P2Y(1) receptor recycling and suggest that SNX1 plays multiple roles in endocytic trafficking of G-protein coupled receptors.
18088323 sortilin and mannose-6-phosphate receptors recycle to the TGN in SNX1-dependent carriers, which we named endosome-to-TGN transport carriers
More...

AA Sequence

MASGGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPKITTSLLPINN      1 - 70
GSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYEELEEEEQE     71 - 140
DQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPP    141 - 210
PPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLS    211 - 280
GAGLLKMFNKATDAVSKMTIKMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKS    281 - 350
LAMLGSSEDNTALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRW    351 - 420
QDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWESRVTQYERDFERISTVVRKEVIRFEKEKSKDFK    421 - 490
NHVIKYLETLLYSQQQLAKYWEAFLPEAKAIS                                          491 - 522
//

Text Mined References (62)

PMID Year Title
26220253 2015 Retromer: Structure, function, and roles in mammalian disease.
25653196 2015 EGF?stimulated AKT activation is mediated by EGFR recycling via an early endocytic pathway in a gefitinib?resistant human lung cancer cell line.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24835695 2014 MiR-95 induces proliferation and chemo- or radioresistance through directly targeting sorting nexin1 (SNX1) in non-small cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152498 2013 Sorting nexin 1 loss results in D5 dopamine receptor dysfunction in human renal proximal tubule cells and hypertension in mice.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
22859339 2012 Silencing of SNX1 by siRNA stimulates the ligand-induced endocytosis of EGFR and increases EGFR phosphorylation in gefitinib-resistant human lung cancer cell lines.
More...