Property Summary

NCBI Gene PubMed Count 36
Grant Count 4
Funding $203,025.98
PubMed Score 66.96
PubTator Score 40.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
psoriasis 1.900 0.000
osteosarcoma 3.632 0.000
glioblastoma 1.500 0.000
group 3 medulloblastoma -1.600 0.001
cystic fibrosis -1.392 0.000
medulloblastoma, large-cell -1.700 0.000
non-small cell lung cancer -2.074 0.000
intraductal papillary-mucinous adenoma (... -2.000 0.001
Hydrolethalus syndrome 1.030 0.048
lung cancer -2.700 0.000
active Crohn's disease -1.267 0.021
active ulcerative colitis -2.952 0.010
interstitial cystitis -1.400 0.016
lung adenocarcinoma -1.900 0.000
pediatric high grade glioma 1.400 0.006
pilocytic astrocytoma 3.000 0.000
subependymal giant cell astrocytoma 2.079 0.014
invasive ductal carcinoma -1.256 0.009
Breast cancer -2.800 0.000
lung carcinoma -1.400 0.000
breast carcinoma -1.400 0.000
ovarian cancer -4.200 0.000
pituitary cancer -2.000 0.000

Gene RIF (23)

PMID Text
24706317 The Single-Nucleotide Polymorphism (SNP) of rs7702187 within the SEMA5A gene would be a high-penetrant risk factor for PD development.
22821546 Using human gastric cancer cell lines, found semaphorin 5A significantly promoted invasive & metastatic abilities of gastric cancer cell in vitro. Semaphorin 5A increased expression of MMP9 by activating phosphorylated ErK1/2 in gastric cancer cell.
22782341 Results suggest that a bioactive, secreted form of Sema5A-ECD has an intriguing and potentially important role in its ability to enhance pancreatic tumour invasiveness, angiogenesis and micrometastases.
21706053 Data show that Semaphorin 5A (Sema5A) and plexin-B3 inhibit glioma cell invasion through Rac1 inactivation.
20802022 The downregulation of SEMA5A in tumor tissue, both at the transcriptional and translational levels, was associated with poor survival among nonsmoking women with NSCLC.
20696765 Data represent a novel signaling of semaphorin 5A and plexin B3 in the control of cell motility by indirect inactivation of Rac1 through RhoGDIalpha.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20073063 data demonstrate that the expression of SEMA5A in pancreatic cancer cells regulates tumorigenesis, growth, invasion and metastasis, and it also suggests a novel target for diagnosis and treatment of pancreatic cancer
19957501 Semaphorin 5a is not implicated in Parkinson's disease risk in a Chinese Han population.
More...

AA Sequence

MKGTCVIAWLFSSLGLWRLAHPEAQGTTQCQRTEHPVISYKEIGPWLREFRAKNAVDFSQLTFDPGQKEL      1 - 70
VVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYIRVLLVGGDRLFTCGTNAFTPVC     71 - 140
TNRSLSNLTEIHDQISGMARCPYSPQHNSTALLTAGGELYAATAMDFPGRDPAIYRSLGILPPLRTAQYN    141 - 210
SKWLNEPNFVSSYDIGNFTYFFFRENAVEHDCGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSR    211 - 280
PGEVPFYYNELQSTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAIAQAFSGPFKYQENSRSAWLPYPN    281 - 350
PNPHFQCGTVDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGREALVHII    351 - 420
YLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILHSQSVLFVGLREHVVKIPLKRCQFY    421 - 490
RTRSTCIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQSISACPTRNLTVDGHFGVWSPWTPCTHTDGSAV    491 - 560
GSCLCRTRSCDSPAPQCGGWQCEGPGMEIANCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHG    561 - 630
GRVCVGQNREERYCNEHLLCPPHMFWTGWGPWERCTAQCGGGIQARRRICENGPDCAGCNVEYQSCNTNP    631 - 700
CPELKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARLADPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSG    701 - 770
DFLRAGRYSAHTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPV    771 - 840
DGVWSCWSPWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWSEWSDWSECEA    841 - 910
SGVQVRARQCILLFPMGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEEKRCGEFNMFHMIAVGLSSSI    911 - 980
LGCLLTLLVYTYCQRYQQQSHDATVIHPVSPAPLNTSITNHINKLDKYDSVEAIKAFNKNNLILEERNKY    981 - 1050
FNPHLTGKTYSNAYFTDLNNYDEY                                                 1051 - 1074
//

Text Mined References (37)

PMID Year Title
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24706317 2014 Meta analysis of the association of rs7702187 SNP in SEMA5A gene with risk of Parkinson's disease.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22821546 2013 Semaphorin 5A, an axon guidance molecule, enhances the invasion and metastasis of human gastric cancer through activation of MMP9.
22782341 2012 Secreted semaphorin 5A suppressed pancreatic tumour burden but increased metastasis and endothelial cell proliferation.
22229870 2012 Genome-wide association of serum uric acid concentration: replication of sequence variants in an island population of the Adriatic coast of Croatia.
21706053 2012 Semaphorin 5A and plexin-B3 regulate human glioma cell motility and morphology through Rac1 and the actin cytoskeleton.
20802022 2010 Identification of a novel biomarker, SEMA5A, for non-small cell lung carcinoma in nonsmoking women.
More...