Property Summary

NCBI Gene PubMed Count 40
PubMed Score 69.76
PubTator Score 40.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Autistic Disorder 364 3.492 1.7
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 0.7
Multiple Sclerosis 540 0.0 1.5
Parkinson's disease 392 0.0 0.8
Disease Target Count Z-score Confidence
Achalasia 13 3.3 1.6

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease -1.267 2.1e-02
active ulcerative colitis -2.003 8.6e-03
Astrocytoma, Pilocytic 3.000 1.6e-09
Breast cancer -1.300 7.1e-19
breast carcinoma -1.100 2.2e-26
cystic fibrosis -1.392 3.1e-04
glioblastoma 1.500 4.2e-04
group 3 medulloblastoma -1.600 1.4e-03
Hydrolethalus syndrome 1.030 4.8e-02
interstitial cystitis -1.100 1.5e-02
intraductal papillary-mucinous adenoma (... -2.000 1.2e-03
invasive ductal carcinoma -1.256 8.9e-03
lung adenocarcinoma -1.700 5.7e-13
lung cancer -1.900 3.4e-03
lung carcinoma -1.400 1.5e-09
malignant mesothelioma -1.500 1.4e-05
medulloblastoma, large-cell -1.700 3.0e-05
non-small cell lung cancer -1.417 2.9e-12
osteosarcoma 3.632 9.5e-07
ovarian cancer -2.100 1.3e-13
pediatric high grade glioma 1.400 6.2e-03
pituitary cancer -1.700 3.5e-07
psoriasis 1.900 4.7e-04
subependymal giant cell astrocytoma 2.079 1.4e-02

Gene RIF (28)

AA Sequence

MKGTCVIAWLFSSLGLWRLAHPEAQGTTQCQRTEHPVISYKEIGPWLREFRAKNAVDFSQLTFDPGQKEL      1 - 70
VVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYIRVLLVGGDRLFTCGTNAFTPVC     71 - 140
TNRSLSNLTEIHDQISGMARCPYSPQHNSTALLTAGGELYAATAMDFPGRDPAIYRSLGILPPLRTAQYN    141 - 210
SKWLNEPNFVSSYDIGNFTYFFFRENAVEHDCGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSR    211 - 280
PGEVPFYYNELQSTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAIAQAFSGPFKYQENSRSAWLPYPN    281 - 350
PNPHFQCGTVDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGREALVHII    351 - 420
YLATDYGTIKKVRVPLNQTSSSCLLEEIELFPERRREPIRSLQILHSQSVLFVGLREHVVKIPLKRCQFY    421 - 490
RTRSTCIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQSISACPTRNLTVDGHFGVWSPWTPCTHTDGSAV    491 - 560
GSCLCRTRSCDSPAPQCGGWQCEGPGMEIANCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHG    561 - 630
GRVCVGQNREERYCNEHLLCPPHMFWTGWGPWERCTAQCGGGIQARRRICENGPDCAGCNVEYQSCNTNP    631 - 700
CPELKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARLADPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSG    701 - 770
DFLRAGRYSAHTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPV    771 - 840
DGVWSCWSPWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWSEWSDWSECEA    841 - 910
SGVQVRARQCILLFPMGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEEKRCGEFNMFHMIAVGLSSSI    911 - 980
LGCLLTLLVYTYCQRYQQQSHDATVIHPVSPAPLNTSITNHINKLDKYDSVEAIKAFNKNNLILEERNKY    981 - 1050
FNPHLTGKTYSNAYFTDLNNYDEY                                                 1051 - 1074
//

Text Mined References (42)

PMID Year Title