Property Summary

NCBI Gene PubMed Count 282
Grant Count 320
R01 Count 201
Funding $41,781,883.36
PubMed Score 617.81
PubTator Score 492.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.500 0.000
osteosarcoma -1.387 0.000
sonic hedgehog group medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.400 0.000

Synonym

Accession Q13586 E9PQJ4 Q8N382
Symbols GOK
TAM
TAM1
IMD10
STRMK
D11S4896E

Gene

PDB

2K60   2MAJ   2MAK   3TEQ   4O9B  

Gene RIF (247)

PMID Text
27069021 Sigma1 receptors attenuates STIM1 coupling to Orai1 and thereby inhibits SOCE.
26826124 T Cell Receptor-induced Nuclear Factor kappaB (NF-kappaB) Signaling and Transcriptional Activation Are Regulated by STIM1- and Orai1-mediated Calcium Entry.
26809794 STIM11-469 and Orai1 W76A mutants do not reduce channel open probability.
26775216 The abundance of mutated STIM1 and the MMP-2 expression were higher in native human umbilical vein endothelial cells of patients with gestational hypertension than controls and were significantly correlated with blood pressure.
26644574 Research on calcium signaling has centered on STIM1, ORAI1, and proteins that modulate their function. TMEM110 regulates the maintenance of ER-plasma membrane junctions and the short-term remodeling of junctions during store-dependent calcium signaling.
26643254 Studies suggest that STIM1 protein and calcium channel Orai1-mediated Ca2+ signaling are the potential target for cancer therapy.
26576490 We demonstrate that the Orai1/STIM1 channel is regulated by changes of both intracellular and extracellular pH.
26560041 study reports recessive STIM1 mutations in patients presenting with amelogenesis imperfecta and hypohidrosis without overt clinical immunodeficiency or myopathy
26546674 N and C-terminal domains of Orai1 synergistically contribute to the interaction with STIM1.
26543234 Data suggest that stromal interaction molecule 1 (STIM1) may be developed as a potential therapeutic target of cancer treatment.
More...

AA Sequence

MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHSEDEKLSFEAVRN      1 - 70
IHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQW     71 - 140
LITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNH    141 - 210
LKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKV    211 - 280
HLEKKLRDEINLAKQEAQRLKELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKW    281 - 350
LQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVT    351 - 420
AALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSM    421 - 490
QSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSHRLI    491 - 560
EGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPV    561 - 630
GDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFKKPLKK                   631 - 685
//

Text Mined References (297)

PMID Year Title
27069021 2016 Sigma1 receptors inhibit store-operated Ca2+ entry by attenuating coupling of STIM1 to Orai1.
26826124 2016 T Cell Receptor-induced Nuclear Factor ?B (NF-?B) Signaling and Transcriptional Activation Are Regulated by STIM1- and Orai1-mediated Calcium Entry.
26809794 2016 The inactivation domain of STIM1 is functionally coupled with the Orai1 pore to enable Ca2+-dependent inactivation.
26775216 2016 A stromal interaction molecule 1 variant up-regulates matrix metalloproteinase-2 expression by strengthening nucleoplasmic Ca2+ signaling.
26644574 2015 TMEM110 regulates the maintenance and remodeling of mammalian ER-plasma membrane junctions competent for STIM-ORAI signaling.
26643254 2016 The store-operated Ca(2+) entry-mediated signaling is important for cancer spread.
26576490 2015 Identification of key amino acid residues responsible for internal and external pH sensitivity of Orai1/STIM1 channels.
26560041 2016 A homozygous STIM1 mutation impairs store-operated calcium entry and natural killer cell effector function without clinical immunodeficiency.
26546674 2016 Cooperative Binding of Stromal Interaction Molecule 1 (STIM1) to the N and C Termini of Calcium Release-activated Calcium Modulator 1 (Orai1).
26543234 2015 Correlation of clinical features and genetic profiles of stromal interaction molecule 1 (STIM1) in colorectal cancers.
More...