Property Summary

NCBI Gene PubMed Count 308
PubMed Score 670.79
PubTator Score 492.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
medulloblastoma, large-cell 6241 2.3e-05
psoriasis 6694 3.3e-05
group 3 medulloblastoma 4104 3.6e-05
osteosarcoma 7950 4.0e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 3.0

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.100 3.6e-05
medulloblastoma, large-cell -1.400 2.3e-05
osteosarcoma -1.387 4.0e-05
psoriasis -2.500 3.3e-05

Protein-protein Interaction (3)

Gene RIF (271)

AA Sequence

MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHSEDEKLSFEAVRN      1 - 70
IHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQW     71 - 140
LITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGPPLLTRHNH    141 - 210
LKDFMLVVSIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKV    211 - 280
HLEKKLRDEINLAKQEAQRLKELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKW    281 - 350
LQLTHEVEVQYYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVT    351 - 420
AALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSM    421 - 490
QSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQMSRAADEALNAMTSNGSHRLI    491 - 560
EGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGSPHLDSSRSHSPSSPDPDTPSPV    561 - 630
GDSRALQASRNTRIPHLAGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFKKPLKK                   631 - 685
//

Text Mined References (323)

PMID Year Title