Property Summary

NCBI Gene PubMed Count 25
PubMed Score 75.96
PubTator Score 73.53

Knowledge Summary

Patent (7,019)

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.500 1.0e-03
pituitary cancer -1.600 1.2e-02
psoriasis -1.400 9.5e-04

Gene RIF (23)

AA Sequence

MGPTLAVPTPYGCIGCKLPQPEYPPALIIFMFCAMVITIVVDLIGNSMVILAVTKNKKLRNSGNIFVVSL      1 - 70
SVADMLVAIYPYPLMLHAMSIGGWDLSQLQCQMVGFITGLSVVGSIFNIVAIAINRYCYICHSLQYERIF     71 - 140
SVRNTCIYLVITWIMTVLAVLPNMYIGTIEYDPRTYTCIFNYLNNPVFTVTIVCIHFVLPLLIVGFCYVR    141 - 210
IWTKVLAARDPAGQNPDNQLAEVRNFLTMFVIFLLFAVCWCPINVLTVLVAVSPKEMAGKIPNWLYLAAY    211 - 280
FIAYFNSCLNAVIYGLLNENFRREYWTIFHAMRHPIIFFSGLISDIREMQEARTLARARAHARDQAREQD    281 - 350
RAHACPAVEETPMNVRNVPLPGDAAAGHPDRASGHPKPHSRSSSAYRKSASTHHKSVFSHSKAASGHLKP    351 - 420
VSGHSKPASGHPKSATVYPKPASVHFKADSVHFKGDSVHFKPDSVHFKPASSNPKPITGHHVSAGSHSKS    421 - 490
AFSAATSHPKPTTGHIKPATSHAEPTTADYPKPATTSHPKPTAADNPELSASHCPEIPAIAHPVSDDSDL    491 - 560
PESASSPAAGPTKPAASQLESDTIADLPDPTVVTTSTNDYHDVVVIDVEDDPDEMAV                 561 - 617
//

Text Mined References (26)

PMID Year Title