Property Summary

NCBI Gene PubMed Count 24
Grant Count 1
Funding $84,664
PubMed Score 74.58
PubTator Score 73.53

Knowledge Summary

Patent (7,019)

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.500 0.001
pituitary cancer -1.600 0.012
psoriasis -1.400 0.001

Synonym

Accession Q13585 Q0VGG3 Q3ZAR0
Symbols H9
Mel1c

Gene

PANTHER Protein Class (2)

 Grant Application (1)

  TechDev Info (1)

Gene RIF (22)

PMID Text
25798330 There was only weak female-specific association between GPR50 variants in late-life depression. No significant associations were observed in men.
25730005 The results provide deeper insight into the functional evolution of GPR50 in mammals at the molecular level
21565467 study found an association between Seasonal Affective Disorder (SAD) and a single nucleotide polymorphism (intronic rs2072621) of the gene encoding GPR50 in females.
20737950 Positive expression of melatonin receptor can be found in human hypertrophic scar and normal skin, but it is higher in scar.
20733416 we found 2 polymorphisms in the GPR50 receptor of patients with adolescent idiopathic scoliosis, but they were not present at a highly significant frequency when compared with controls
20733416 Observational study of gene-disease association. (HuGE Navigator)
20657642 Observational study of gene-disease association. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
20377855 Observational study of gene-disease association. (HuGE Navigator)
20371266 This is the first association of rs1202874 with BD and is the second positive association at the GPR50 locus.
More...

AA Sequence

MGPTLAVPTPYGCIGCKLPQPEYPPALIIFMFCAMVITIVVDLIGNSMVILAVTKNKKLRNSGNIFVVSL      1 - 70
SVADMLVAIYPYPLMLHAMSIGGWDLSQLQCQMVGFITGLSVVGSIFNIVAIAINRYCYICHSLQYERIF     71 - 140
SVRNTCIYLVITWIMTVLAVLPNMYIGTIEYDPRTYTCIFNYLNNPVFTVTIVCIHFVLPLLIVGFCYVR    141 - 210
IWTKVLAARDPAGQNPDNQLAEVRNFLTMFVIFLLFAVCWCPINVLTVLVAVSPKEMAGKIPNWLYLAAY    211 - 280
FIAYFNSCLNAVIYGLLNENFRREYWTIFHAMRHPIIFFSGLISDIREMQEARTLARARAHARDQAREQD    281 - 350
RAHACPAVEETPMNVRNVPLPGDAAAGHPDRASGHPKPHSRSSSAYRKSASTHHKSVFSHSKAASGHLKP    351 - 420
VSGHSKPASGHPKSATVYPKPASVHFKADSVHFKGDSVHFKPDSVHFKPASSNPKPITGHHVSAGSHSKS    421 - 490
AFSAATSHPKPTTGHIKPATSHAEPTTADYPKPATTSHPKPTAADNPELSASHCPEIPAIAHPVSDDSDL    491 - 560
PESASSPAAGPTKPAASQLESDTIADLPDPTVVTTSTNDYHDVVVIDVEDDPDEMAV                 561 - 617
//

Text Mined References (25)

PMID Year Title
25798330 2015 Involvement of GPR50 polymorphisms in depression: independent replication in a prospective elderly cohort.
25730005 2015 Uneven evolutionary rate of the melatonin-related receptor gene (GPR50) in primates.
25416956 2014 A proteome-scale map of the human interactome network.
21565467 2012 Association of the intronic rs2072621 polymorphism of the X-linked GPR50 gene with affective disorder with seasonal pattern.
20737950 2010 [The expression of melatonin receptor in human hypertrophic scar].
20733416 2010 Evaluation of GPR50, hMel-1B, and ROR-alpha melatonin-related receptors and the etiology of adolescent idiopathic scoliosis.
20657642 2010 Identification of pathway-biased and deleterious melatonin receptor mutants in autism spectrum disorders and in the general population.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20377855 2010 Mutation screening of melatonin-related genes in patients with autism spectrum disorders.
20371266 2010 Association of GPR50, an X-linked orphan G protein-coupled receptor, and affective disorder in an independent sample of the Scottish population.
More...