Property Summary

NCBI Gene PubMed Count 31
Grant Count 21
R01 Count 14
Funding $862,021.53
PubMed Score 24.13
PubTator Score 20.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Chronic Lymphocytic Leukemia -1.051 0.004
esophageal adenocarcinoma 2.000 0.018
astrocytoma 1.100 0.000
glioblastoma 3.200 0.000
osteosarcoma -1.337 0.040
ependymoma 3.900 0.000
medulloblastoma 2.200 0.001
atypical teratoid / rhabdoid tumor 3.900 0.000
medulloblastoma, large-cell 1.600 0.002
primitive neuroectodermal tumor 3.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.296 0.004
non-small cell lung cancer -1.249 0.000
lung cancer -1.700 0.001
colon cancer -1.300 0.010
diabetes mellitus -1.200 0.031
interstitial cystitis 1.500 0.000
pediatric high grade glioma 2.700 0.000
pilocytic astrocytoma 1.400 0.000
lung carcinoma -1.900 0.000
Breast cancer -1.700 0.000
ulcerative colitis -1.400 0.000

Gene RIF (17)

PMID Text
26549344 Thus, these data identified IQGAP2 as a novel tumor suppressor for ovarian cancer to inhibit cell invasion through regulating Wnt/b-catenin signaling, and provided a new biomarker and potential therapeutic strategy for this disease.
26154927 we identified IQGAP2 as a human and zebrafish podocyte gene product that is downregulated in microarray data sets from kidney biopsies of human patients with focal segmental glomerulosclerosis and minimal change nephrotic syndrome.
26047140 Data show that IQ motif-containing GTPase-activating protein 2 (IQGAP2) expression is altered in colitis.
25722290 IQGAP1, IQGAP2, and IQGAP3 have diverse roles in vertebrate physiology, operating in the kidney, nervous system, cardiovascular system, pancreas, and lung. (Review)
25229330 Mammalian IQGAP proteins may play a role in cytokinesis by regulating the localization of key cytokinesis regulatory proteins to the contractile apparatus during mitosis.
24998570 Low IQGAP2 expression was associated with hepatocellular carcinoma.
22406297 observations strongly indicate that IQGAP2 is a surveillance type of tumour suppressor for prostate cancer
21299499 The first IQ-motifs from IQGAP2 and IQGAP3 form transient interactions with calmodulin in the absence of calcium.
20977743 increased IQGAP1 and/or decreased IQGAP2 contribute to the pathogenesis of human HCC.
20800603 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPHEELPSLQRPRYGSIVDDERLSAEEMDERRRQNIAYEYLCHLEEAKRWMEVCLVEELPPTTELEEGLR      1 - 70
NGVYLAKLAKFFAPKMVSEKKIYDVEQTRYKKSGLHFRHTDNTVQWLRAMESIGLPKIFYPETTDVYDRK     71 - 140
NIPRMIYCIHALSLYLFKLGIAPQIQDLLGKVDFTEEEISNMRKELEKYGIQMPSFSKIGGILANELSVD    141 - 210
EAALHAAVIAINEAVEKGIAEQTVVTLRNPNAVLTLVDDNLAPEYQKELWDAKKKKEENARLKNSCISEE    211 - 280
ERDAYEELLTQAEIQGNINKVNRQAAVDHINAVIPEGDPENTLLALKKPEAQLPAVYPFAAAMYQNELFN    281 - 350
LQKQNTMNYLAHEELLIAVEMLSAVALLNQALESNDLVSVQNQLRSPAIGLNNLDKAYVERYANTLLSVK    351 - 420
LEVLSQGQDNLSWNEIQNCIDMVNAQIQEENDRVVAVGYINEAIDEGNPLRTLETLLLPTANISDVDPAH    421 - 490
AQHYQDVLYHAKSQKLGDSESVSKVLWLDEIQQAVDDANVDKDRAKQWVTLVVDVNQCLEGKKSSDILSV    491 - 560
LKSSTSNANDIIPECADKYYDALVKAKELKSERVSSDGSWLKLNLHKKYDYYYNTDSKESSWVTPESCLY    561 - 630
KESWLTGKEIEDIIEEVTVGYIRENIWSASEELLLRFQATSSGPILREEFEARKSFLHEQEENVVKIQAF    631 - 700
WKGYKQRKEYMHRRQTFIDNTDSIVKIQSWFRMATARKSYLSRLQYFRDHNNEIVKIQSLLRANKARDDY    701 - 770
KTLVGSENPPLTVIRKFVYLLDQSDLDFQEELEVARLREEVVTKIRANQQLEKDLNLMDIKIGLLVKNRI    771 - 840
TLEDVISHSKKLNKKKGGEMEILNNTDNQGIKSLSKERRKTLETYQQLFYLLQTNPLYLAKLIFQMPQNK    841 - 910
STKFMDTVIFTLYNYASNQREEYLLLKLFKTALEEEIKSKVDQVQDIVTGNPTVIKMVVSFNRGARGQNT    911 - 980
LRQLLAPVVKEIIDDKSLIINTNPVEVYKAWVNQLETQTGEASKLPYDVTTEQALTYPEVKNKLEASIEN    981 - 1050
LRRVTDKVLNSIISSLDLLPYGLRYIAKVLKNSIHEKFPDATEDELLKIVGNLLYYRYMNPAIVAPDGFD   1051 - 1120
IIDMTAGGQINSDQRRNLGSVAKVLQHAASNKLFEGENEHLSSMNNYLSETYQEFRKYFKEACNVPEPEE   1121 - 1190
KFNMDKYTDLVTVSKPVIYISIEEIISTHSLLLEHQDAIAPEKNDLLSELLGSLGEVPTVESFLGEGAVD   1191 - 1260
PNDPNKANTLSQLSKTEISLVLTSKYDIEDGEAIDSRSLMIKTKKLIIDVIRNQPGNTLTEILETPATAQ   1261 - 1330
QEVDHATDMVSRAMIDSRTPEEMKHSQSMIEDAQLPLEQKKRKIQRNLRTLEQTGHVSSENKYQDILNEI   1331 - 1400
AKDIRNQRIYRKLRKAELAKLQQTLNALNKKAAFYEEQINYYDTYIKTCLDNLKRKNTRRSIKLDGKGEP   1401 - 1470
KGAKRAKPVKYTAAKLHEKGVLLDIDDLQTNQFKNVTFDIIATEDVGIFDVRSKFLGVEMEKVQLNIQDL   1471 - 1540
LQMQYEGVAVMKMFDKVKVNVNLLIYLLNKKFYGK                                      1541 - 1575
//

Text Mined References (41)

PMID Year Title
26549344 2016 Epigenetic regulation of IQGAP2 promotes ovarian cancer progression via activating Wnt/?-catenin signaling.
26154927 2015 The Rho-GTPase binding protein IQGAP2 is required for the glomerular filtration barrier.
26047140 2015 IQ Motif-Containing GTPase-Activating Protein 2 (IQGAP2) Is a Novel Regulator of Colonic Inflammation in Mice.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25722290 2015 The biology of IQGAP proteins: beyond the cytoskeleton.
25229330 2014 Involvement of IQGAP family proteins in the regulation of mammalian cell cytokinesis.
24998570 2014 Differential expression of IQGAP1/2 in Hepatocellular carcinoma and its relationship with clinical outcomes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...