Property Summary

NCBI Gene PubMed Count 38
Grant Count 20
R01 Count 8
Funding $3,016,510.66
PubMed Score 85.18
PubTator Score 22.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.450 0.000
group 3 medulloblastoma -1.600 0.004
posterior fossa group B ependymoma -1.200 0.000

Gene RIF (20)

PMID Text
25921290 Redundant and specialized roles for diacylglycerol kinases alpha and zeta in the control of T cell functions.
25450975 This study shows that DGKzeta knockdown facilitates degradation of IkappaB, followed by nuclear translocation of NF-kappaB p65 subunit.
24646293 Elevated DGKzeta expression contributes to increased Rho GTPase activation and the enhanced motility of metastatic cancer cells.
23723068 Data indicate that after P2Y6 receptor stimulation both phospholipase D (PLD) and DGKzeta enzymes are responsible for producing phosphatidic acid (PA).
22895365 DGK regulates melanogenesis via modulation of the posttranslational processing of tyrosinase, which may be related with the protein degradation machinery.
22271650 Antigen-specific CD8-positive T cells from DGKzeta-deficient transgenic mice show enhanced expansion and increased cytokine production after lymphocytic choriomeningitis virus infection, yet DGK-deficient memory CD8+ T cells exhibit impaired expansion.
21996351 Nucleosome assembly protein (NAP) 1-like 1 (NAP1L1) and NAP1-like 4 (NAP1L4) are identified as novel DGKzeta binding partners.
21937721 DGK-zeta translocated rapidly to the plasma membrane at early stages of immunological synapse (IS) formation independent of enzyme activity; study highlights a DGKzeta-specific function for local diacylglycerol metabolism at the IS and offers new clues to its mode of regulation
21194521 Data show that Diacylglycerol that 2-arachidonoyl glycerol is a very poor substrate for either the epsilon or the zeta isoforms of diacylglycerol kinases.
19308020 None of SNPs of diacylglycerol kinase zeta tested showed association with bipolar disorder in Sardinian sample.
More...

AA Sequence

METFFRRHFRGKVPGPGEGQQRPSSVGLPTGKARRRSPAGQASSSLAQRRRSSAQLQGCLLSCGVRAQGS      1 - 70
SRRRSSTVPPSCNPRFIVDKVLTPQPTTVGAQLLGAPLLLTGLVGMNEEEGVQEDVVAEASSAIQPGTKT     71 - 140
PGPPPPRGAQPLLPLPRYLRRASSHLLPADAVYDHALWGLHGYYRRLSQRRPSGQHPGPGGRRASGTTAG    141 - 210
TMLPTRVRPLSRRRQVALRRKAAGPQAWSALLAKAITKSGLQHLAPPPPTPGAPCSESERQIRSTVDWSE    211 - 280
SATYGEHIWFETNVSGDFCYVGEQYCVARMLKSVSRRKCAACKIVVHTPCIEQLEKINFRCKPSFRESGS    281 - 350
RNVREPTFVRHHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMLQQIEEPCS    351 - 420
LGVHAAVVIPPTWILRARRPQNTLKASKKKKRASFKRKSSKKGPEEGRWRPFIIRPTPSPLMKPLLVFVN    421 - 490
PKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPKEALEMYRKVHNLRILACGGDGTVGWILSTLDQLRLKP    491 - 560
PPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEGNVVQLDRWDLHAEPNPEAGPEDRDEGATDR    561 - 630
LPLDVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGM    631 - 700
DLTPKIQDLKPQCVVFLNIPRYCAGTMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERL    701 - 770
TQCREVVLTTSKAIPVQVDGEPCKLAASRIRIALRNQATMVQKAKRRSAAPLHSDQQPVPEQLRIQVSRV    771 - 840
SMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSPKWCFLDAT    841 - 910
TASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQG    911 - 980
EELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAVSTGSKDVVRYLLDHAPPEILDAVEENGETC    981 - 1050
LHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQMIQREDQETAV      1051 - 1117
//

Text Mined References (42)

PMID Year Title
25921290 2015 Redundant and specialized roles for diacylglycerol kinases ? and ? in the control of T cell functions.
25450975 2015 Downregulation of diacylglycerol kinase ? enhances activation of cytokine-induced NF-?B signaling pathway.
24646293 2014 Increased diacylglycerol kinase ? expression in human metastatic colon cancer cells augments Rho GTPase activity and contributes to enhanced invasion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23723068 2013 Regulation of phospholipase D activity and phosphatidic acid production after purinergic (P2Y6) receptor stimulation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22895365 2012 Diacylglycerol kinase regulates tyrosinase expression and function in human melanocytes.
22627129 2012 Biosynthesis of alkyl lysophosphatidic acid by diacylglycerol kinases.
22271650 2012 Differential regulation of primary and memory CD8 T cell immune responses by diacylglycerol kinases.
21996351 2011 Interaction of nucleosome assembly proteins abolishes nuclear localization of DGK? by attenuating its association with importins.
More...