Property Summary

NCBI Gene PubMed Count 58
PubMed Score 46.12
PubTator Score 618.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.2e-05
group 3 medulloblastoma 4104 1.5e-04
lung cancer 4740 3.5e-03
Multiple myeloma 1332 4.0e-03
psoriasis 6694 4.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.300 1.5e-04
lung cancer 1.200 3.5e-03
Multiple myeloma 1.012 4.0e-03
ovarian cancer -1.200 1.2e-05
psoriasis -1.200 4.7e-03

Gene RIF (31)

AA Sequence

MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVA      1 - 70
QYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAI     71 - 140
KEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPP    141 - 210
RFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHI    211 - 280
NENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEAR    281 - 350
ERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDS    351 - 420
GFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREG    421 - 490
PVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE                            491 - 536
//

Text Mined References (75)

PMID Year Title