Property Summary

NCBI Gene PubMed Count 22
PubMed Score 23.13
PubTator Score 17.63

Knowledge Summary

Patent (806)

TINX Plot

  Disease Sources (3)

Disease Target Count
Neoplasm Invasiveness 127
Disease Target Count P-value
atypical teratoid/rhabdoid tumor 1095 1.5930182114632E-12
group 4 medulloblastoma 1875 2.29159680599905E-9
pediatric high grade glioma 2712 1.76494529444369E-6
posterior fossa group A ependymoma 1511 7.20583099947221E-6
medulloblastoma, large-cell 6234 3.78095621262498E-5
ovarian cancer 8492 4.75997758277508E-5
glioblastoma 5572 3.70535811979865E-4
osteosarcoma 7933 9.42828598544072E-4
primitive neuroectodermal tumor 3031 0.00161854584931892
ductal carcinoma in situ 1745 0.00441928239978349
fibroadenoma 557 0.0105621187254673
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0310723801346175

Expression

  Differential Expression (12)

Synonym

Accession Q13572 Q9BTL6 Q9H2E7
Symbols ITRPK1

Gene

PDB

2ODT   2Q7D   2QB5  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

 Collection (1)

 GWAS Trait (1)

Gene RIF (9)

PMID Text
24465924 The results suggested that the maternal rs3783903 of ITPK1 might be associated with spina bifida, and the allele G of rs3783903 might affect the binding of AP-1 and the decrease of maternal plasma inositol hexakisphosphate concentration.
22928859 Activation of PLC by an endogenous cytokine (GBP) in Drosophila S3 cells and its application as a model for studying inositol phosphate signalling through ITPK1.
22308441 HEK293 cells stably expressing acetylated ITPK1 had reduced levels of the higher phosphorylated forms of inositol, compared with the levels seen in cells expressing unacetylated ITPK1
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Observational study of gene-disease association. (HuGE Navigator)
17616525 analysis of inositol phosphate signaling pathway integration via human ITPK1
12925536 5/6-kinase modifies TNFalpha-induced apoptosis by interfering with the activation of TNF-R1-associated death domain

AA Sequence

MQTFLKGKRVGYWLSEKKIKKLNFQAFAELCRKRGMEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQN      1 - 70
DSQSLELVHRFQEYIDAHPETIVLDPLPAIRTLLDRSKSYELIRKIEAYMEDDRICSPPFMELTSLCGDD     71 - 140
TMRLLEKNGLTFPFICKTRVAHGTNSHEMAIVFNQEGLNAIQPPCVVQNFINHNAVLYKVFVVGESYTVV    141 - 210
QRPSLKNFSAGTSDRESIFFNSHNVSKPESSSVLTELDKIEGVFERPSDEVIRELSRALRQALGVSLFGI    211 - 280
DIIINNQTGQHAVIDINAFPGYEGVSEFFTDLLNHIATVLQGQSTAMAATGDVALLRHSKLLAEPAGGLV    281 - 350
GERTCSASPGCCGSMMGQDAPWKAEADAGGTAKLPHQRLGCNAGVSPSFQQHCVASLATKASSQ          351 - 414
//

Text Mined References (25)

PMID Year Title
24465924 2014 The maternal ITPK1 gene polymorphism is associated with neural tube defects in a high-risk Chinese population.
23472165 2013 Genome-wide association study link novel loci to endometriosis.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22928859 2012 Activation of PLC by an endogenous cytokine (GBP) in Drosophila S3 cells and its application as a model for studying inositol phosphate signalling through ITPK1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22308441 2012 Regulation of inositol 1,3,4-trisphosphate 5/6-kinase (ITPK1) by reversible lysine acetylation.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...