Property Summary

NCBI Gene PubMed Count 22
PubMed Score 24.78
PubTator Score 17.63

Knowledge Summary

Patent (806)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.400 5.8e-06
atypical teratoid / rhabdoid tumor -1.800 1.0e-08
ductal carcinoma in situ -1.100 4.4e-03
ependymoma -1.100 2.9e-05
fibroadenoma -1.500 1.1e-02
glioblastoma -1.300 1.6e-07
group 3 medulloblastoma -1.200 1.0e-04
intraductal papillary-mucinous neoplasm ... -1.100 3.1e-02
medulloblastoma, large-cell -1.600 3.8e-05
osteosarcoma -1.673 9.4e-04
ovarian cancer 1.300 4.8e-05
primitive neuroectodermal tumor -1.300 1.6e-03

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MQTFLKGKRVGYWLSEKKIKKLNFQAFAELCRKRGMEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQN      1 - 70
DSQSLELVHRFQEYIDAHPETIVLDPLPAIRTLLDRSKSYELIRKIEAYMEDDRICSPPFMELTSLCGDD     71 - 140
TMRLLEKNGLTFPFICKTRVAHGTNSHEMAIVFNQEGLNAIQPPCVVQNFINHNAVLYKVFVVGESYTVV    141 - 210
QRPSLKNFSAGTSDRESIFFNSHNVSKPESSSVLTELDKIEGVFERPSDEVIRELSRALRQALGVSLFGI    211 - 280
DIIINNQTGQHAVIDINAFPGYEGVSEFFTDLLNHIATVLQGQSTAMAATGDVALLRHSKLLAEPAGGLV    281 - 350
GERTCSASPGCCGSMMGQDAPWKAEADAGGTAKLPHQRLGCNAGVSPSFQQHCVASLATKASSQ          351 - 414
//

Text Mined References (25)

PMID Year Title