Property Summary

NCBI Gene PubMed Count 14
Grant Count 3
R01 Count 3
Funding $363,410.5
PubMed Score 13.59
PubTator Score 16.72

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13571 Q13240 Q14698 Q3KP54
Symbols CLAST6

Gene

PANTHER Protein Class (1)

 GO Process (1)

Gene RIF (7)

PMID Text
25998573 Insufficient expression of LAPTM5 may take part in the pathogenesis of systemic lupus erythematosus (SLE) and contribute to the severity of the disease, none of LAPTM5 polymorphisms contributes significantly to SLE susceptibility in a Chinese population.
22880058 The interaction of LAPTM5 with CD1e and their colocalization in antigen processing compartments both suggest that LAPTM5 might influence the role of CD1e in the presentation of lipid antigens.
22009753 LAPTM5 is a substrate of the ITCH-mediated degradation and its protein level is negatively regulated by ITCH
19787053 LAPTM5-mediated programmed cell death is closely associated with the spontaneous regression of neuroblastomas
18187620 Knockdown of lysosomal protein transmembrane 5 (LAPTM5) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
12886255 results suggest that loss of E3 gene expression might be a crucial event during the progression of human MM
12527926 LAPTM5 shows stage-specific expression during B cell differentiation. It may be involved in B cell malignancies.

AA Sequence

MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRIADLISSFLLI      1 - 70
TMLFIISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAYLKLASRSRASSSKFPLMTLQ     71 - 140
LLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMPHNQFIKMMIIFSIAFITVLIFKVYMFKCVW    141 - 210
RCYRLIKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEV                      211 - 262
//

Text Mined References (15)

PMID Year Title
26903547 2016 Exome sequencing reveals recurrent germ line variants in patients with familial Waldenström macroglobulinemia.
25998573 2015 Expression and Polymorphisms of Lysosome-Associated Protein Transmembrane 5 (LAPTM5) in Patients with Systemic Lupus Erythematosus in a Chinese Population.
25416956 2014 A proteome-scale map of the human interactome network.
22880058 2012 Lysosomal-associated transmembrane protein 5 (LAPTM5) is a molecular partner of CD1e.
22009753 2011 HECT-type ubiquitin ligase ITCH targets lysosomal-associated protein multispanning transmembrane 5 (LAPTM5) and prevents LAPTM5-mediated cell death.
19787053 2009 Lysosomal-associated protein multispanning transmembrane 5 gene (LAPTM5) is associated with spontaneous regression of neuroblastomas.
18203646 2008 Correlative gene expression and DNA methylation profiling in lung development nominate new biomarkers in lung cancer.
18202799 2008 A three-gene predictor for early intrahepatic recurrence of hepatocellular carcinoma after curative hepatectomy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
More...