Property Summary

NCBI Gene PubMed Count 17
PubMed Score 14.37
PubTator Score 16.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Glomerulonephritis, IGA 34 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count
IGA Glomerulonephritis 50

Expression

  Differential Expression (33)

Disease log2 FC p
astrocytoma 2.000 1.9e-02
Astrocytoma, Pilocytic 1.400 7.9e-07
Becker muscular dystrophy 1.191 1.3e-03
Breast cancer 1.600 2.6e-02
breast carcinoma 1.100 3.9e-12
chronic kidney disease 1.800 1.8e-02
cutaneous lupus erythematosus 2.200 9.6e-05
dermatomyositis 1.500 4.4e-03
diabetes mellitus -2.000 4.8e-02
Down syndrome 1.300 2.2e-02
Duchenne muscular dystrophy 1.107 1.7e-09
ductal carcinoma in situ 1.100 3.0e-02
esophageal adenocarcinoma 1.300 1.9e-02
gastric carcinoma 1.700 3.6e-02
glioblastoma 1.200 2.1e-04
group 3 medulloblastoma -1.100 3.8e-02
head and neck cancer and chronic obstruc... 1.100 6.4e-04
interstitial cystitis 1.800 2.2e-03
invasive ductal carcinoma 1.586 1.6e-03
juvenile dermatomyositis 1.621 9.5e-09
limb girdle muscular dystrophy 2A 1.387 7.1e-06
lung cancer -1.400 4.6e-03
lung carcinoma -3.000 2.4e-34
medulloblastoma, large-cell -1.700 1.5e-04
ovarian cancer -1.700 4.8e-04
pancreatic cancer 1.100 3.5e-03
pediatric high grade glioma 1.500 3.6e-04
primary pancreatic ductal adenocarcinoma 1.110 2.1e-03
primary Sjogren syndrome 1.300 9.9e-03
psoriasis 1.700 4.6e-04
subependymal giant cell astrocytoma 2.053 7.6e-03
ulcerative colitis 2.400 6.3e-05
Waldenstrons macroglobulinemia 1.539 4.4e-03

Gene RIF (9)

AA Sequence

MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRIADLISSFLLI      1 - 70
TMLFIISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAYLKLASRSRASSSKFPLMTLQ     71 - 140
LLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMPHNQFIKMMIIFSIAFITVLIFKVYMFKCVW    141 - 210
RCYRLIKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEV                      211 - 262
//

Text Mined References (18)

PMID Year Title