Property Summary

NCBI Gene PubMed Count 83
PubMed Score 297.58
PubTator Score 140.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.300 3.7e-05
dermatomyositis 2.200 1.9e-04
glioblastoma 1.300 4.1e-03
group 3 medulloblastoma 2.400 3.4e-05
invasive ductal carcinoma 1.100 4.6e-03
lung cancer 2.400 9.1e-05
medulloblastoma, large-cell 1.900 5.1e-07
Multiple myeloma 1.139 1.6e-02
osteosarcoma -1.518 1.4e-03
Pick disease -1.200 1.9e-03
primitive neuroectodermal tumor 1.400 1.4e-04
progressive supranuclear palsy -1.100 3.1e-02
Waldenstrons macroglobulinemia 1.462 1.4e-02

PDB (18)

Gene RIF (60)

AA Sequence

MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEP      1 - 70
KQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGIN     71 - 140
PGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFRE    141 - 210
GGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFP    211 - 280
RAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENP    281 - 350
CSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA              351 - 410
//

Text Mined References (89)

PMID Year Title