Property Summary

NCBI Gene PubMed Count 79
Grant Count 68
R01 Count 47
Funding $4,717,943.66
PubMed Score 280.29
PubTator Score 140.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.462 0.014
Multiple myeloma 1.139 0.016
osteosarcoma -1.518 0.001
group 3 medulloblastoma 2.400 0.000
glioblastoma 1.300 0.004
medulloblastoma, large-cell 1.900 0.000
primitive neuroectodermal tumor 1.400 0.000
lung cancer 2.400 0.000
atypical teratoid/rhabdoid tumor 1.300 0.000
Pick disease -1.200 0.002
progressive supranuclear palsy -1.100 0.031
invasive ductal carcinoma 1.100 0.005
dermatomyositis 2.200 0.000

Synonym

Accession Q13569 Q8IUZ6 Q8IZM3
Symbols hTDG

Gene

TDG

PDB

1WYW   2D07   2RBA   3UFJ   3UO7   3UOB   4FNC   4JGC   4XEG   4Z3A   4Z47   4Z7B   4Z7Z   5CYS  

Gene RIF (57)

PMID Text
26917720 findings indicate that sumoylation and SUMO binding are not essential for TDG-mediated excision and repair of 5-carboxylcytosine bases.
26751644 NEIL1 and NEIL2 cooperate with TDG during base excision: TDG occupies the abasic site and is displaced by NEILs, which further process the baseless sugar, thereby stimulating TDG-substrate turnover.
26544625 Data show that Ras protein regulates inhibitor of growth protein 4 (ING4)-thymine-DNA glycosylase (TDG)-Fas protein axis to promote apoptosis resistance in pancreatic cancer.
26358812 TDG releases the excised base from its tight product complex with abasic DNA, contrary to previous reports. Moreover, DNA-free TDG exhibits no significant binding to free nucleobases (uracil, thymine, 5-hydroxymethyluracil)
26320595 Computational modeling study investigated the glycosidic bond cleavage reaction in human thymine DNA glycosylase
26207381 levels of TET3 and TDG mRNAs were independent prognostic factors for early breast cancer patients who received anthracycline chemotherapy
25735432 A long TA repeat in the promoter region of IL28B was associated with spontaneous HCV clearance.
25712093 Data indicate that both thymine-DNA glycosylase (hTDG) and a second glycosylase, hOGG1, recognized structurally different 8-oxoguanine lesions.
25375110 these results suggest that individuals harboring the G199S in Thymine DNA glycosylase variant may have increased risk for developing cancer.
25087872 Results show TARID binds to the TCF21 promoter and recruits GADD45A and TDG to direct base excision repair for demethylation.
More...

AA Sequence

MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEP      1 - 70
KQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGIN     71 - 140
PGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFRE    141 - 210
GGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFP    211 - 280
RAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENP    281 - 350
CSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA              351 - 410
//

Text Mined References (84)

PMID Year Title
26917720 2016 Characterizing Requirements for Small Ubiquitin-like Modifier (SUMO) Modification and Binding on Base Excision Repair Activity of Thymine-DNA Glycosylase in Vivo.
26751644 2016 Neil DNA glycosylases promote substrate turnover by Tdg during DNA demethylation.
26544625 2015 Oncogenic Ras suppresses ING4-TDG-Fas axis to promote apoptosis resistance.
26358812 2015 Thymine DNA glycosylase exhibits negligible affinity for nucleobases that it removes from DNA.
26320595 2015 Mechanism of the Glycosidic Bond Cleavage of Mismatched Thymine in Human Thymine DNA Glycosylase Revealed by Classical Molecular Dynamics and Quantum Mechanical/Molecular Mechanical Calculations.
26207381 2015 Reduced Expression of TET1, TET2, TET3 and TDG mRNAs Are Associated with Poor Prognosis of Patients with Early Breast Cancer.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25735432 2015 A thymine-adenine dinucleotide repeat polymorphism near IL28B is associated with spontaneous clearance of hepatitis C virus.
25712093 2015 Lesion search and recognition by thymine DNA glycosylase revealed by single molecule imaging.
More...