Tbio | Interferon regulatory factor 5 |
Transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection. Activated by TLR7 or TLR8 signaling.
This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Multiple transcript variants encoding different isoforms have been found for this gene, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. [provided by RefSeq, Mar 2010]
This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Multiple transcript variants encoding different isoforms have been found for this gene, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. [provided by RefSeq, Mar 2010]
Comments
Disease | Target Count | P-value |
---|---|---|
osteosarcoma | 7933 | 1.8613255589822E-4 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
systemic lupus erythematosus | 172 | 5.742 | 2.9 |
Systemic scleroderma | 66 | 3.964 | 2.0 |
Crohn's disease | 304 | 0.0 | 2.0 |
ulcerative colitis | 2087 | 0.0 | 2.0 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Rheumatoid Arthritis | 1171 | 3.708 | 1.9 |
Disease | Target Count |
---|---|
Diffuse cutaneous systemic sclerosis | 17 |
Primary biliary cirrhosis | 45 |
limited scleroderma | 19 |
Disease | Target Count |
---|---|
Systemic lupus erythematosus 10 | 1 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Opossum | OMA Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Xenopus | OMA Inparanoid |
PMID | Text |
---|---|
27092776 | IRF5 and PADI4 significantly discriminated between RA patients and healthy controls in LDA. |
26613957 | IRF5 and IRF8, two transcription factors with opposing functions, control TLR9 signaling in human plasmacytoid dendritic cells. |
26519527 | the data demonstrate a critical mechanism by which sex differences in basal plasmacytoid dendritic cell IRF5 expression lead to higher IFN-alpha production upon TLR7 stimulation in females. |
26294277 | Genetic associations and gene-gene interactions of IRF5 and TYK2 were significantly detected in Han Chinese with systemic lupus erythematosus |
26233721 | meta-analysis demonstrated the IRF5 rs2070197 polymorphism conferred susceptibility to systemic lupus erythematosus (SLE) in all subjects without inter-study heterogeneity; IRF5 rs2070197 polymorphism was identified as risk factors for SLE in Caucasian populations but it had no effects in Asians |
26112714 | four single nucleotide polymorphisms studied in IRF5 may affect neither Neuromyelitis optica nor Multiple sclerosis in the Southeastern Han Chinese population |
26004104 | Study indicates that high-level IRF-5 expression is specific to HTLV-1-infected T cells and regulated by Tax viral protein. |
25649192 | A conserved region within interferon regulatory factor 5 controls breast cancer cell migration through a cytoplasmic and transcription-independent mechanism. |
25572744 | Polymorphisms of IRF5 may play an important role in susceptibility to systemic sclerosis. |
25564941 | The polymorphisms in the IRF5 gene may play a role in the development of Crohn's Disease in the Malaysian population, as seen in the significant associations of SNPs, that is, rs3807306, rs10954213 and rs11770589. |
More... |
MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKE 1 - 70 TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGA 71 - 140 GEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGF 141 - 210 RELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLE 211 - 280 ATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPC 281 - 350 ASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVP 351 - 420 VAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPW 421 - 490 PMHPAGMQ 491 - 498 //
PMID | Year | Title |
---|---|---|
27092776 | 2016 | A Combination of CD28 (rs1980422) and IRF5 (rs10488631) Polymorphisms Is Associated with Seropositivity in Rheumatoid Arthritis: A Case Control Study. |
26613957 | 2016 | IRF5 and IRF8 modulate the CAL-1 human plasmacytoid dendritic cell line response following TLR9 ligation. |
26519527 | 2015 | Sex Differences in Plasmacytoid Dendritic Cell Levels of IRF5 Drive Higher IFN-? Production in Women. |
26294277 | 2015 | Genetic association and interaction between the IRF5 and TYK2 genes and systemic lupus erythematosus in the Han Chinese population. |
26233721 | 2015 | Association of the IRF5 rs2070197 polymorphism with systemic lupus erythematosus: a meta-analysis. |
26112714 | 2015 | Variants of Interferon Regulatory Factor 5 are Associated with Neither Neuromyelitis Optica Nor Multiple Sclerosis in the Southeastern Han Chinese Population. |
26004104 | 2015 | Constitutive expression of IRF-5 in HTLV-1-infected T cells. |
25649192 | 2015 | A conserved region within interferon regulatory factor 5 controls breast cancer cell migration through a cytoplasmic and transcription-independent mechanism. |
25572744 | Association of the IRF5 SNP rs2004640 with systemic sclerosis in Han Chinese. | |
25564941 | 2015 | Association between genetic polymorphisms in interferon regulatory factor 5 (IRF5) gene and Malaysian patients with Crohn's disease. |
More... |