Property Summary

NCBI Gene PubMed Count 197
Grant Count 103
R01 Count 40
Funding $10,373,701.97
PubMed Score 219.77
PubTator Score 246.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.060 0.000

Gene

PANTHER Protein Class (1)

PDB

3DSH  

Gene RIF (216)

PMID Text
27092776 IRF5 and PADI4 significantly discriminated between RA patients and healthy controls in LDA.
26613957 IRF5 and IRF8, two transcription factors with opposing functions, control TLR9 signaling in human plasmacytoid dendritic cells.
26519527 the data demonstrate a critical mechanism by which sex differences in basal plasmacytoid dendritic cell IRF5 expression lead to higher IFN-alpha production upon TLR7 stimulation in females.
26294277 Genetic associations and gene-gene interactions of IRF5 and TYK2 were significantly detected in Han Chinese with systemic lupus erythematosus
26233721 meta-analysis demonstrated the IRF5 rs2070197 polymorphism conferred susceptibility to systemic lupus erythematosus (SLE) in all subjects without inter-study heterogeneity; IRF5 rs2070197 polymorphism was identified as risk factors for SLE in Caucasian populations but it had no effects in Asians
26112714 four single nucleotide polymorphisms studied in IRF5 may affect neither Neuromyelitis optica nor Multiple sclerosis in the Southeastern Han Chinese population
26004104 Study indicates that high-level IRF-5 expression is specific to HTLV-1-infected T cells and regulated by Tax viral protein.
25649192 A conserved region within interferon regulatory factor 5 controls breast cancer cell migration through a cytoplasmic and transcription-independent mechanism.
25572744 Polymorphisms of IRF5 may play an important role in susceptibility to systemic sclerosis.
25564941 The polymorphisms in the IRF5 gene may play a role in the development of Crohn's Disease in the Malaysian population, as seen in the significant associations of SNPs, that is, rs3807306, rs10954213 and rs11770589.
More...

AA Sequence

MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKE      1 - 70
TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGA     71 - 140
GEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGF    141 - 210
RELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLE    211 - 280
ATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPC    281 - 350
ASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVP    351 - 420
VAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPW    421 - 490
PMHPAGMQ                                                                  491 - 498
//

Text Mined References (199)

PMID Year Title
27092776 2016 A Combination of CD28 (rs1980422) and IRF5 (rs10488631) Polymorphisms Is Associated with Seropositivity in Rheumatoid Arthritis: A Case Control Study.
26613957 2016 IRF5 and IRF8 modulate the CAL-1 human plasmacytoid dendritic cell line response following TLR9 ligation.
26519527 2015 Sex Differences in Plasmacytoid Dendritic Cell Levels of IRF5 Drive Higher IFN-? Production in Women.
26294277 2015 Genetic association and interaction between the IRF5 and TYK2 genes and systemic lupus erythematosus in the Han Chinese population.
26233721 2015 Association of the IRF5 rs2070197 polymorphism with systemic lupus erythematosus: a meta-analysis.
26112714 2015 Variants of Interferon Regulatory Factor 5 are Associated with Neither Neuromyelitis Optica Nor Multiple Sclerosis in the Southeastern Han Chinese Population.
26004104 2015 Constitutive expression of IRF-5 in HTLV-1-infected T cells.
25649192 2015 A conserved region within interferon regulatory factor 5 controls breast cancer cell migration through a cytoplasmic and transcription-independent mechanism.
25572744 Association of the IRF5 SNP rs2004640 with systemic sclerosis in Han Chinese.
25564941 2015 Association between genetic polymorphisms in interferon regulatory factor 5 (IRF5) gene and Malaysian patients with Crohn's disease.
More...