Property Summary

NCBI Gene PubMed Count 209
PubMed Score 240.97
PubTator Score 246.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
osteosarcoma 7950 2.5e-04

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.024 2.5e-04

Gene RIF (225)

AA Sequence

MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKE      1 - 70
TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGA     71 - 140
GEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGF    141 - 210
RELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLE    211 - 280
ATQEQVELFGPISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPC    281 - 350
ASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVP    351 - 420
VAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPW    421 - 490
PMHPAGMQ                                                                  491 - 498
//

Text Mined References (210)

PMID Year Title