Property Summary

Ligand Count 3
NCBI Gene PubMed Count 26
PubMed Score 22.56
PubTator Score 20.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Alzheimer's disease 658 3.184 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.300 3.4e-02
lung cancer 1.700 9.3e-03
Multiple myeloma 1.158 1.5e-02
ovarian cancer -1.800 1.2e-04
sonic hedgehog group medulloblastoma 1.100 2.4e-04

Protein-protein Interaction (1)

Gene RIF (10)

AA Sequence

MAQLGKLLKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDA      1 - 70
GNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLA     71 - 140
DVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLDKPFPELREHFQSYDLDHMEKKDHS    141 - 210
HTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQ    211 - 280
IPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKA    281 - 350
KKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPD    351 - 420
NEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVHEFCRYGAAEP    421 - 490
HTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL                              491 - 534
//

Text Mined References (30)

PMID Year Title