Property Summary

NCBI Gene PubMed Count 26
Grant Count 8
R01 Count 5
Funding $718,108.63
PubMed Score 21.08
PubTator Score 20.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.158 0.015
intraductal papillary-mucinous neoplasm ... 1.300 0.034
lung cancer 1.700 0.009
sonic hedgehog group medulloblastoma 1.100 0.000
ovarian cancer -1.800 0.000

Synonym

Accession Q13564 A6NCK0 A6NFN4 A8MU28 B2R700 B3KUP9
Symbols HPP1
ula-1
APPBP1
A-116A10.1

Gene

PANTHER Protein Class (1)

PDB

1R4M   1R4N   1TT5   1YOV   2NVU   3DBH   3DBL   3DBR   3GZN  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
651699 screening 2123 / 0 / 362045 uHTS identification of inhibitors of cullin neddylation in a TR-FRET assay
651722 summary 0 / 0 / 0 Summary assay for small molecule inhibitors of cullin neddylation
652217 screening 235 / 0 / 1597 Single concentration confirmation of inhibitors of cullin neddylation in a TR-FRET assay
652247 confirmatory 27 / 0 / 177 Dose-response confirmation of inhibitors of cullin neddylation in a TR-FRET assay

Gene RIF (10)

PMID Text
26215564 HIV-1 Vpu depends on NAE1-mediated neddylation (covalent addition of NEDD8 protein onto cullin backbone lysine residue rendering the cullin-RING E3 ubiquitin ligase complex catalytically active) to downregulate CD4
25229838 E1 (NAE1 and UBA3) and E2 (UBC12) enzymes, as well as global NEDD8 conjugation, were upregulated in over 2/3 of human intrahepatic cholangiocarcinoma
23185368 analysis of a metal-based inhibitor of NEDD8-activating enzyme
22182960 our results suggest that APP-BP1 modulates neuronal differentiation by altering gene expression profiles in fetal neural stem cells
21151996 APP-BP1 plays an important role in the cell cycle progression of fetal neural stem cells
19795456 APP-BP1 displayed decreased expression levels in HPV-positive head and neck squamous cell carcinoma
18627766 APP-BP1 is degraded by ubiquitin-dependent proteolysis.
14690597 Data report the structure of the quaternary complex between human APPBP1-UBA3, a heterodimeric E1, its ubl NEDD8, and ATP.
12740388 Conservation in the mechanism of Nedd8 activation by the human AppBp1-Uba3 heterodimer.
12646924 structure and mutational analysis of human APPBP1-UBA3, the heterodimeric E1 enzyme for NEDD8

AA Sequence

MAQLGKLLKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDA      1 - 70
GNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLA     71 - 140
DVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLDKPFPELREHFQSYDLDHMEKKDHS    141 - 210
HTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQ    211 - 280
IPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKA    281 - 350
KKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPD    351 - 420
NEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVHEFCRYGAAEP    421 - 490
HTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL                              491 - 534
//

Text Mined References (30)

PMID Year Title
25229838 2014 Neddylation pathway is up-regulated in human intrahepatic cholangiocarcinoma and serves as a potential therapeutic target.
23185368 2012 A metal-based inhibitor of NEDD8-activating enzyme.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22182960 2012 Amyloid precursor protein binding protein-1 knockdown reduces neuronal differentiation in fetal neural stem cells.
21269460 2011 Initial characterization of the human central proteome.
21151996 2010 Amyloid precursor protein binding protein-1 modulates cell cycle progression in fetal neural stem cells.
19795456 2010 Biological and clinical relevance of transcriptionally active human papillomavirus (HPV) infection in oropharynx squamous cell carcinoma.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18627766 2008 TRIP12 functions as an E3 ubiquitin ligase of APP-BP1.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...