Property Summary

NCBI Gene PubMed Count 166
Grant Count 731
R01 Count 426
Funding $68,245,182.86
PubMed Score 491.34
PubTator Score 535.89

Knowledge Summary

Patent (44,745)

Expression

Synonym

Accession Q13563 O60441 Q15764 Q2M1Q3 Q2M1Q5
Symbols PC2
PKD4
Pc-2
APKD2
TRPP2

Gene

PDB

2KLD   2KLE   2KQ6   2Y4Q   3HRN   3HRO   5K47  

Gene RIF (131)

PMID Text
26692149 Results show that some of the previously reported missense or synonymous mutations in PKD2 gene caused altered pre-mRNA splicing.
26580203 PKD2 and RSK1 regulate integrin beta4 phosphorylation at threonine 1736 to stabilize keratinocyte cell adhesion and its hemidesmosomes.
26574436 The coiled-coil domain in the PC2 C-terminal forms a stable helix bundle regardless of the presence of Ca(2+).
26507660 PKD2 is a core factor in the formation of this multiprotein complex at the TGN that controls constitutive secretion of matrix metalloproteinase cargo.
26435415 Human polycystin-2 transgene dose-dependently rescues autosomal-dominant polycystic kidney disease phenotypes in Pkd2 mutant mice
26286632 PCs expression and p53 activation as a regulator of cell proliferation were further evaluated in vivo and in 69 advanced human carotid atherosclerotic plaques.
26269590 The data indicate that the cAMP pathway regulates PC2-mediated cation transport in the hST
25861040 FLNA anchors PC2 to the actin cytoskeleton through complex PC2-FLNA-actin to reduce degradation and increase stability, and possibly regulate PC2 function in a Ca-dependent manner.
25716316 There is only one Ca2+ binding site in the human PC2 C-terminus, located within its EF-hand domain; the Ca2+ binding affinity of the C-terminal trimer is greatly enhanced.
25367197 Both polycystins were detected on the spindle and mid-body of mitotic cells, while fibrocystin was on centrosome throughout cell cycle.
More...

AA Sequence

MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLAAPGGLCEQRGLEIEMQRIRQAAARDPPAG      1 - 70
AAASPSPPLSSCSRQAWSRDNPGFEAEEEEEEVEGEEGGMVVEMDVEWRPGSRRSAASSAVSSVGARSRG     71 - 140
LGGYHGAGHPSGRRRRREDQGPPCPSPVGGGDPLHRHLPLEGQPPRVAWAERLVRGLRGLWGTRLMEESS    141 - 210
TNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFW    211 - 280
KFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSV    281 - 350
SSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTR    351 - 420
ATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVE    421 - 490
EILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLEDQNTFPNFEHLAYWQIQFNN    491 - 560
IAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQ    561 - 630
ECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMEL    631 - 700
SDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQEL    701 - 770
TEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQ    771 - 840
VLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVR    841 - 910
EELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGGNGSSNVHV                911 - 968
//

Text Mined References (172)

PMID Year Title
26692149 2016 Three exonic mutations in polycystic kidney disease-2 gene (PKD2) alter splicing of its pre-mRNA in a minigene system.
26580203 2015 PKD2 and RSK1 Regulate Integrin ?4 Phosphorylation at Threonine 1736.
26574436 2016 Conformational dynamics of Ca2+-dependent responses in the polycystin-2 C-terminal tail.
26507660 2016 Protein Kinase D2 Assembles a Multiprotein Complex at the Trans-Golgi Network to Regulate Matrix Metalloproteinase Secretion.
26435415 2015 Human polycystin-2 transgene dose-dependently rescues ADPKD phenotypes in Pkd2 mutant mice.
26286632 2015 Elevated expression of mechanosensory polycystins in human carotid atherosclerotic plaques: association with p53 activation and disease severity.
26269590 2015 The cAMP Signaling Pathway and Direct Protein Kinase A Phosphorylation Regulate Polycystin-2 (TRPP2) Channel Function.
25861040 2015 Filamin-a increases the stability and plasma membrane expression of polycystin-2.
25716316 2015 Oligomerization of the polycystin-2 C-terminal tail and effects on its Ca2+-binding properties.
25416956 2014 A proteome-scale map of the human interactome network.
More...