Property Summary

NCBI Gene PubMed Count 54
PubMed Score 67.42
PubTator Score 42.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.5e-15
psoriasis 6694 2.8e-06
diabetes mellitus 1728 1.0e-03

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.200 1.0e-03
osteosarcoma -5.058 1.5e-15
psoriasis -3.700 2.8e-06

 MGI Phenotype (1)

Protein-protein Interaction (11)

Gene RIF (11)

AA Sequence

MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAEELTSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFS      1 - 70
DRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKIKTTVKESATEEKLTPVLLAK     71 - 140
QLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLLLQLEATKNSKGGSGGKTTGTPPDSSLVTYELH    141 - 210
SRPEQDKFSQAAKVAELEKRLTELETAVRCDQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVE    211 - 280
ARLQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLL    281 - 350
THLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKLGK                       351 - 401
//

Text Mined References (63)

PMID Year Title