Property Summary

NCBI Gene PubMed Count 49
Grant Count 16
R01 Count 12
Funding $1,214,550.46
PubMed Score 67.31
PubTator Score 42.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -3.700 0.000
osteosarcoma -5.058 0.000
diabetes mellitus -1.200 0.001

 MGI Term (1)

Gene RIF (10)

PMID Text
25375884 Over-expression of p50/dynamitin results in upregulated amounts of pelletable HIV-1 CA cores in infected cells
25088759 dynamitin is involved in the regulation of Nav1.5 cell-surface density
20463029 the determinants of p50/DM required for self-oligomerization of the protein and for interactions with other subunits of the dynactin complex
19286658 Over-expression of p50/dynamitin results in upregulated amounts of pelletable HIV-1 CA cores in infected cells
18782227 The interaction between ZW10 and dynamitin showed that the N-terminal region of ZW10 is the major binding site for dynamitin and, like full-length ZW10, could move along microtubules to the centrosomal area in a dynein-dynactin-dependent manner.
18182012 Data show how dynamitin's different structural domains contribute to its ability to self-associate, interact with dynactin and assemble into a complex with its close binding partner, p24.
16369996 study does not support a major role for DCTN2 overexpression in carcinogenesis
15813749 DCTN2 is required in the earliest stages of peroxisome biogenesis.
15580264 the Sec23p component of the COPII complex directly interacts with the dynactin complex through the carboxy-terminal cargo-binding domain of p150(Glued).
14983524 Altered levels of Cep135 and p50 by RNAi and protein overexpression caused the release of endogenous partner molecules from centrosomes.

AA Sequence

MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAEELTSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFS      1 - 70
DRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKIKTTVKESATEEKLTPVLLAK     71 - 140
QLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLLLQLEATKNSKGGSGGKTTGTPPDSSLVTYELH    141 - 210
SRPEQDKFSQAAKVAELEKRLTELETAVRCDQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVE    211 - 280
ARLQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLL    281 - 350
THLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKLGK                       351 - 401
//

Text Mined References (58)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
25416956 2014 A proteome-scale map of the human interactome network.
25088759 2014 Dynamitin affects cell-surface expression of voltage-gated sodium channel Nav1.5.
24816561 2014 Ccdc13 is a novel human centriolar satellite protein required for ciliogenesis and genome stability.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23704327 2013 The giant spectrin ?V couples the molecular motors to phototransduction and Usher syndrome type I proteins along their trafficking route.
23414759 2013 The herpesvirus VP1/2 protein is an effector of dynein-mediated capsid transport and neuroinvasion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
More...