Property Summary

NCBI Gene PubMed Count 64
Grant Count 5
R01 Count 5
Funding $934,511.33
PubMed Score 14.56
PubTator Score 21.97

Knowledge Summary

Patent (3,199)

Expression

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (22)

PMID Text
26198034 CaMKIId activity is up-regulated in the myocardium of diabetic patients and mouse models of diabetes, where it promotes pathological signaling that includes hypertrophy, fibrosis and apoptosis.
25421395 Reveal a novel in vivo function of CaMKIIdelta in regulating H3 phosphorylation and suggest a novel epigenetic mechanism by which CaMKIIdelta controls cardiac hypertrophy.
25266122 Study found a significant association with disordered gambling and rs167771 (DRD3) and with rs381572 (CAMK2D) in humans
24986638 This study showed that AKAP12,CAMK2D and a molecular pathway(cyclic amp)association to outcome of depressive during citalopram treatment.
24302721 CaMKIID specifically phosphorylates Thr-457 on CEACAM1-SF, which in turn regulates the process of lumen formation via apoptosis of the central acinar cells.
24196533 CAMKIIdelta is required for PP1gamma-exacerbated apoptosis of cardiomyocytes.
24030498 Our studies suggest that CaMKII is a molecular signal that couples increased reactive oxygen species with atrial fibrillation and that therapeutic strategies to decrease oxidized CaMKII may prevent or reduce it.
23283722 End-stage failing human hearts had more phosphorylation at CaMKII-dependent titin sites, contributing to their mechanical dysfunction & establishing a new role for CaMKIIdelta in regulating diastolic passive properties of healthy & diseased hearts.
22270398 suggest that CaMKII and calcineurin provide a switch-like mechanism that controls Ca-dependent LIMK1, SSH1L and cofilin activation, and subsequently actin cytoskeletal reorganization
21491429 Data show that Pcp4 overexpression induces precocious neuronal differentiation, and is associated with an increase in CaMKIIdelta activation.
More...

AA Sequence

MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLEREARICRLLKH      1 - 70
PNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRDLKPE     71 - 140
NLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKDPYGKPVDMWACGVILYILLVG    141 - 210
YPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVAS    211 - 280
MMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEI    281 - 350
IKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH    351 - 420
LVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFS    421 - 490
GGTSLWQNI                                                                 491 - 499
//

Text Mined References (76)

PMID Year Title
26198034 2015 The role of CaMKII in diabetic heart dysfunction.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25421395 2015 Control of histone H3 phosphorylation by CaMKII? in response to haemodynamic cardiac stress.
25416956 2014 A proteome-scale map of the human interactome network.
25266122 2015 Addiction-related genes in gambling disorders: new insights from parallel human and pre-clinical models.
25145502 2015 Genome-wide association study of survival in early-stage non-small cell lung cancer.
24986638 2015 A molecular pathway analysis of the glutamatergic-monoaminergic interplay serves to investigate the number of depressive records during citalopram treatment.
24302721 2014 Phosphorylation of CEACAM1 molecule by calmodulin kinase IID in a three-dimensional model of mammary gland lumen formation.
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...