Property Summary

NCBI Gene PubMed Count 121
PubMed Score 6.24
PubTator Score 788.48

Knowledge Summary

Patent (10,273)

Expression

Gene

PDB

2UX0   2V7O  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (51)

PMID Text
26803057 Demonstrate that calcium/CaMKIIgamma/AKT signaling can regulate apoptosis and autophagy simultaneously in colorectal cancer cells.
25965829 High CaMKIIgamma expression is associated with lung cancer.
25613138 The gene expression of calcium/calmodulin-dependent protein kinase II gamma is significantly upregulated in both clade B and clade C Tat treated SK-N-MC cells
25577293 Dysfunction in CaMKII-based signaling has been linked with a host of cardiovascular phenotypes including heart failure and arrhythmia, and CaMKII levels are elevated in human and animal disease models of heart disease.
25446257 Inhibition of CaMKII activity results in an upregulation of CaMKIV mRNA and protein in leukemia cell lines.
24634301 CaMKII-dependent microtube polymerization may be responsible for the enhanced uptake of PEI/ON complexes in A549 cells under oxidative stress conditions.
24269630 When inhibiting CaMKII, B-cell activating factor (BAFF) is attenuated and mediates protein phosphatase (PP)2A-Erk1/2 signaling and B-cell proliferation.
24206096 CAMKIIgamma, HSP70 and HSP90 transcripts are differentially expressed in chronic myeloid leukemia cells from patients with resistant mutated disease.
24198379 The gene expression of calcium/calmodulin-dependent protein kinase II gamma is significantly upregulated in both clade B and clade C Tat treated SK-N-MC cells
24189456 our findings described a previously uncharacterized role of CaMKIIgamma in non-small cell lung cancer
More...

AA Sequence

MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICRLLKH      1 - 70
PNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQHDIVHRDLKPE     71 - 140
NLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVG    141 - 210
YPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVAS    211 - 280
MMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSAAKSLLNKKSDGGVKKRKSSSSVHLMPQSNNKNSL    281 - 350
VSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKARSPEGRSSRDRTAPSAGMQPQPSL    351 - 420
CSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPI    421 - 490
HTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ      491 - 558
//

Text Mined References (131)

PMID Year Title
26803057 2016 SKF-96365 activates cytoprotective autophagy to delay apoptosis in colorectal cancer cells through inhibition of the calcium/CaMKII?/AKT-mediated pathway.
25965829 2015 Ca2+/calmodulin-dependent protein kinase II? enhances stem-like traits and tumorigenicity of lung cancer cells.
25577293 2015 Role of CaMKII in cardiac arrhythmias.
25446257 2015 A novel crosstalk between calcium/calmodulin kinases II and IV regulates cell proliferation in myeloid leukemia cells.
24634301 2014 Hydrogen peroxide enhances the uptake of polyethylenimine/oligonucleotide complexes in A549 cells by activating CaMKII independent of [Ca(2+)]c elevation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269630 2014 BAFF activates Erk1/2 promoting cell proliferation and survival by Ca2+-CaMKII-dependent inhibition of PP2A in normal and neoplastic B-lymphoid cells.
24206096 2014 CAMKII?, HSP70 and HSP90 transcripts are differentially expressed in chronic myeloid leukemia cells from patients with resistant mutated disease.
24189456 2014 Ca(2+)/calmodulin-dependent protein kinase II?, a critical mediator of the NF-?B network, is a novel therapeutic target in non-small cell lung cancer.
24100685 2013 Regulation of ASIC1 by Ca2+/calmodulin-dependent protein kinase II in human glioblastoma multiforme.
More...