Property Summary

NCBI Gene PubMed Count 70
Grant Count 7
R01 Count 4
Funding $221,740.83
PubMed Score 52.66
PubTator Score 51.24

Knowledge Summary

Patent (12,914)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -3.100 0.007
posterior fossa group A ependymoma -3.300 0.000
oligodendroglioma -2.500 0.000
psoriasis -2.500 0.000
glioblastoma -4.200 0.000
osteosarcoma 1.474 0.000
sonic hedgehog group medulloblastoma -4.300 0.000
atypical teratoid / rhabdoid tumor -5.900 0.000
medulloblastoma, large-cell -3.800 0.000
primitive neuroectodermal tumor -2.800 0.000
pediatric high grade glioma -4.000 0.000
pilocytic astrocytoma -3.400 0.000
inflammatory breast cancer -1.700 0.000
lung carcinoma 3.500 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (25)

PMID Text
25045698 Due to similarity of structure variations, we suggest that these compounds may have an effect on beta-CaMKII and that sengesterone may have a similar efficacy as the control.
22750393 beta-carotene reverses the IL-1beta-mediated reduction in paraoxonase-1 expression via induction of the CaMKKII pathway in human endothelial cells
21884935 Study presents the crystal structure of an autoinhibited full-length human CaMKII holoenzyme, revealing an unexpected compact arrangement of kinase domains docked against a central hub, with the calmodulin-binding sites completely inaccessible.
21871176 Promoter methylations of CAMK2B and ARFGEF1 are novel epigenetic markers identified in breast cancer cell lines.
21610080 Characterization of a central Ca2+/calmodulin-dependent protein kinase IIalpha/beta binding domain in densin that selectively modulates glutamate receptor subunit phosphorylation.
21479273 The novel cGMP/PKG/ROS/calmodulin/CaMKII signaling pathway may regulate cardiomyocyte excitability by opening K(ATP) channels and contribute to cardiac protection against ischemia-reperfusion injury.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
18302935 These FLIM versions of Camui could be useful for elucidating the function of CaMKII both in vitro and in vivo.
More...

AA Sequence

MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLLKH      1 - 70
SNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPE     71 - 140
NLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKEAYGKPVDIWACGVILYILLVG    141 - 210
YPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVAS    211 - 280
MMHRQETVECLKKFNARRKLKGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKAD    281 - 350
GVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSANTTIEDEDAKAPRVPDILSSVR    351 - 420
RGSGAPEAEGPLPCPSPAPFSPLPAPSPRISDILNSVRRGSGTPEAEGPLSAGPPPCLSPALLGPLSSPS    421 - 490
PRISDILNSVRRGSGTPEAEGPSPVGPPPCPSPTIPGPLPTPSRKQEIIKTTEQLIEAVNNGDFEAYAKI    491 - 560
CDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQG    561 - 630
RPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPLQ                                      631 - 666
//

Text Mined References (76)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25045698 2014 Possible inhibitor from traditional Chinese medicine for the ? form of calcium-dependent protein kinase type II in the treatment of major depressive disorder.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23989986 2014 A meta-analysis of genome-wide association studies identifies novel variants associated with osteoarthritis of the hip.
22750393 2012 ?-carotene reverses the IL-1?-mediated reduction in paraoxonase-1 expression via induction of the CaMKKII pathway in human endothelial cells.
22399527 2012 Genome-wide screen for metabolic syndrome susceptibility Loci reveals strong lipid gene contribution but no evidence for common genetic basis for clustering of metabolic syndrome traits.
21884935 2011 A mechanism for tunable autoinhibition in the structure of a human Ca2+/calmodulin- dependent kinase II holoenzyme.
21871176 2011 Downregulation of ARFGEF1 and CAMK2B by promoter hypermethylation in breast cancer cells.
21610080 2011 Characterization of a central Ca2+/calmodulin-dependent protein kinase IIalpha/beta binding domain in densin that selectively modulates glutamate receptor subunit phosphorylation.
21529938 2011 Analysis of CaM-kinase signaling in cells.
More...