Property Summary

NCBI Gene PubMed Count 475
Grant Count 329
R01 Count 228
Funding $30,384,880.77
PubMed Score 866.14
PubTator Score 741.69

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13547 Q92534 HD1
Symbols HD1
RPD3
GON-10
RPD3L1

Gene

PANTHER Protein Class (2)

PDB

1TYI   4BKX   5ICN  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651918 confirmatory 0 / 0 / 1 ML327 E-Cadherin HDAC Spectrum Assay_HDAC1

Gene RIF (276)

PMID Text
26912629 We demonstrate that HDAC1 is a component of host innate antiviral response against IAV, and IAV undermines HDAC1 to limit its role in antiviral response.
26812044 HDAC1 and DAXX are co-repressors associated with epigenetic regulation that help to control promoter histone acetylation reactions involved in regulating GAD67.
26759222 Data show that histone H2B of prostate cancer cell line DU-145 have hypoacetylation, hypomethylation, and dephosphorylation, suggesting there was an excessive histone deacetylase activity in the cells.
26697414 These observations indicate a HDAC1-mediated IL-12B gene expression suppression by live, virulent Mycobacterium tuberculosis to subvert the immune system to survive and replicate in the host.
26588579 the expression of HDAC1 was significantly higher in LRS than that in HRS. The positive rates for stage III-IV tumor were significantly higher than those for stage II.
26549310 RORgammat is acetylated, and this acetylation is reciprocally regulated by the histone acetyltransferase p300 and the histone deacetylase HDAC1.
26502922 Enhanced HDAC-1 expression in Pancreatic Adenocarcinoma was significantly associated with increased tumor proliferative capacity, borderline with the absence of lymph node metastases, and showed longer survival times compared to those with low expression.
26290249 Here we demonstrate in the rat hippocampus that ongoing experience powerfully modifies the molecular response to one such intervention, histone deacetylase inhibitor (HDACi) administration.
26255936 simultaneous depletion of HDAC1/2 compromises the deacetylation of H3K56Ac, while depletion of HDAC1 or HDAC2 alone has no effect on H3K56Ac.
26152200 Study shows evidence implicating HDAC1 as an important regulator of tissue damage in rheumatoid arthritis (RA). Its inhibition in RA synovial fibroblasts results in attenuation of the autoaggressive phenotype as reduced proliferation and migration.
More...

AA Sequence

MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSD      1 - 70
DYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLH     71 - 140
HAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGD    141 - 210
LRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKG    211 - 280
HAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNM    281 - 350
TNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF    351 - 420
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA            421 - 482
//

Text Mined References (503)

PMID Year Title
27616479 2016 De Novo Mutations in CHD4, an ATP-Dependent Chromatin Remodeler Gene, Cause an Intellectual Disability Syndrome with Distinctive Dysmorphisms.
26912629 2016 Influenza A Virus Dysregulates Host Histone Deacetylase 1 That Inhibits Viral Infection in Lung Epithelial Cells.
26812044 2016 Toward dissecting the etiology of schizophrenia: HDAC1 and DAXX regulate GAD67 expression in an in vitro hippocampal GABA neuron model.
26759222 2016 Hypoacetylation, hypomethylation, and dephosphorylation of H2B histones and excessive histone deacetylase activity in DU-145 prostate cancer cells.
26697414 2015 Mycobacterium tuberculosis Infection Induces HDAC1-Mediated Suppression of IL-12B Gene Expression in Macrophages.
26588579 2016 A correlation analysis between HDAC1 over-expression and clinical features of laryngeal squamous cell carcinoma.
26549310 2015 Reciprocal regulation of ROR?t acetylation and function by p300 and HDAC1.
26502922 2015 Histone deacetylase (HDAC)-1, -2, -4 and -6 expression in human pancreatic adenocarcinoma: associations with clinicopathological parameters, tumor proliferative capacity and patients' survival.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26290249 2015 Experience Modulates the Effects of Histone Deacetylase Inhibitors on Gene and Protein Expression in the Hippocampus: Impaired Plasticity in Aging.
More...