Property Summary

NCBI Gene PubMed Count 194
Grant Count 87
R01 Count 49
Funding $13,043,087.08
PubMed Score 169.39
PubTator Score 481.92

Knowledge Summary

Patent (20,387)

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.200 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.500 0.000
lung cancer -1.400 0.001
pediatric high grade glioma 1.100 0.000
pilocytic astrocytoma 1.100 0.000
ovarian cancer 1.600 0.000

Synonym

Accession Q13546 A0AV89 B2RAG1 B4E3F9 Q13180 Q59H33
Symbols RIP
RIP1
RIP-1

Gene

PDB

4ITH   4ITI   4ITJ   4NEU   5HX6  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (123)

PMID Text
27493188 By promoting both inflammation and cell death, RIPK1 may be a common mediator of axonal pathology in amyotrophic lateral sclerosis.
26575016 Report role of RIP1 in Smac mimetic mediated chemosensitization of neuroblastoma cells.
26460489 Down-regulating RIP1 promotes oxaliplatin induced Tca8113 cells apoptosis
26313915 CD40 ligand induces RIP1-dependent, necroptosis-like cell death in low-grade serous but not serous borderline ovarian tumor cells.
26297639 RIPK1 and RIPK2 are targets of HIV-1 Protease activity during infection, and their inactivation may contribute to modulation of cell death and host defense pathways by HIV-1
26297639 PR cleavage of RIPK1 disrupts RIPK1 function
26297639 PR cleavage of RIPK1 disrupts RIPK1 function
26297639 PR cleavage of RIPK1 disrupts RIPK1 function
26297639 PR cleavage of RIPK1 disrupts RIPK1 function
26195820 cFLIP-mediated and caspase-8-dependent limited cleavage of RIP1 is a new layer of mechanism that promotes NF-KB activation and lymphoma survival.
More...

AA Sequence

MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRL      1 - 70
RHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLK     71 - 140
PENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSD    141 - 210
VYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPG    211 - 280
IEEKFRPFYLSQLEESVEEDVKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLG    281 - 350
MGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF    351 - 420
AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWY    421 - 490
RPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDST    491 - 560
NTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQ    561 - 630
MLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN                                 631 - 671
//

Text Mined References (203)

PMID Year Title
27493188 2016 RIPK1 mediates axonal degeneration by promoting inflammation and necroptosis in ALS.
26575016 2015 Differential role of RIP1 in Smac mimetic-mediated chemosensitization of neuroblastoma cells.
26559832 2015 Herpes Simplex Virus 1 (HSV-1) and HSV-2 Mediate Species-Specific Modulations of Programmed Necrosis through the Viral Ribonucleotide Reductase Large Subunit R1.
26460489 2015 Down-Regulating Receptor Interacting Protein Kinase 1 (RIP1) Promotes Oxaliplatin-Induced Tca8113 Cell Apoptosis.
26313915 2015 CD40 ligand induces RIP1-dependent, necroptosis-like cell death in low-grade serous but not serous borderline ovarian tumor cells.
26297639 2015 HIV-1 protease cleaves the serine-threonine kinases RIPK1 and RIPK2.
26195820 2015 RIP1 Cleavage in the Kinase Domain Regulates TRAIL-Induced NF-?B Activation and Lymphoma Survival.
26086143 2015 The diverse role of RIP kinases in necroptosis and inflammation.
26018731 2015 RIPK1 regulates survival of human melanoma cells upon endoplasmic reticulum stress through autophagy.
25939870 2015 ZFP36 stabilizes RIP1 via degradation of XIAP and cIAP2 thereby promoting ripoptosome assembly.
More...