Property Summary

Ligand Count 30
NCBI Gene PubMed Count 222
PubMed Score 211.84
PubTator Score 481.92

Knowledge Summary

Patent (20,387)

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.100 9.5e-04
Astrocytoma, Pilocytic 1.100 3.8e-06
atypical teratoid / rhabdoid tumor 1.500 4.6e-06
ependymoma 1.200 8.8e-10
glioblastoma 1.500 2.5e-04
lung cancer -1.400 8.2e-04
ovarian cancer 1.600 3.3e-07

Protein-protein Interaction (4)

Gene RIF (143)

AA Sequence

MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRL      1 - 70
RHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLK     71 - 140
PENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSD    141 - 210
VYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPG    211 - 280
IEEKFRPFYLSQLEESVEEDVKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLG    281 - 350
MGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF    351 - 420
AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWY    421 - 490
RPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDST    491 - 560
NTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQ    561 - 630
MLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN                                 631 - 671
//

Text Mined References (232)

PMID Year Title