Property Summary

NCBI Gene PubMed Count 31
Grant Count 17
R01 Count 12
Funding $1,026,221.99
PubMed Score 32.12
PubTator Score 20.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (13)

PMID Text
25533957 results highlight stabilization of a phosphorylation-induced fold as the essential mechanism for phospho-regulation of the 4E-BP:eIF4E interaction and exemplify a new mode of biological regulation mediated by intrinsically disordered proteins
24206664 mTORC1 controls mitochondrial activity and biogenesis by selectively promoting translation of nucleus-encoded mitochondria-related mRNAs via inhibition of the eukaryotic translation initiation factor 4E (eIF4E)-binding proteins (4E-BPs).
21661078 Data show that the eIF4E binding preference for 4E-BP2 over 4E-BP1 is based on stacking of Arg63 side chain on Trp73 indole ring of eIF4E and construction of hydrophobic space around the Trp73 indole ring by the Leu59-Leu60 sequence of 4E-BP2.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20424163 isoaspartate formation repair modulates the interaction of deamidated 4E-BP2 with mTORC1 in brain
19913121 Observational study of gene-disease association. (HuGE Navigator)
19244480 4E-BPs regulate the stress granule localization of eIF4E
18789325 The C-terminal His74-Glu89 region of 4EBP2 acts as an auxiliary function for the major binding of Y(X)4L -binding motif (Tyr54-Leu60) to eIF4E.
16385451 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQT      1 - 70
PPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI                         71 - 120
//

Text Mined References (36)

PMID Year Title
25533957 2015 Folding of an intrinsically disordered protein by phosphorylation as a regulatory switch.
25416956 2014 A proteome-scale map of the human interactome network.
24207126 2013 Interaction of the eukaryotic initiation factor 4E with 4E-BP2 at a dynamic bipartite interface.
24206664 2013 mTORC1 controls mitochondrial activity and biogenesis through 4E-BP-dependent translational regulation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21661078 2011 Structural scaffold for eIF4E binding selectivity of 4E-BP isoforms: crystal structure of eIF4E binding region of 4E-BP2 and its comparison with that of 4E-BP1.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20424163 2010 Repair of isoaspartate formation modulates the interaction of deamidated 4E-BP2 with mTORC1 in brain.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
More...