Property Summary

NCBI Gene PubMed Count 34
PubMed Score 33.40
PubTator Score 20.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
ductal carcinoma in situ -1.100 2.7e-04
group 4 medulloblastoma 1.600 2.2e-05
intraductal papillary-mucinous adenoma (... 1.100 5.8e-04
invasive ductal carcinoma -1.700 3.7e-04
medulloblastoma, large-cell 1.400 1.2e-04
osteosarcoma -1.541 7.9e-05
ovarian cancer -1.200 2.8e-07
pancreatic ductal adenocarcinoma liver m... -1.001 4.5e-03
psoriasis -1.400 1.1e-04
tuberculosis 1.200 1.4e-07
ulcerative colitis -1.200 7.1e-09

Gene RIF (15)

AA Sequence

MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQT      1 - 70
PPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI                         71 - 120
//

Text Mined References (38)

PMID Year Title