Property Summary

NCBI Gene PubMed Count 182
Grant Count 418
R01 Count 273
Funding $40,324,584.93
PubMed Score 534.74
PubTator Score 371.73

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13541 B2R502 D3DSW8 Q6IBN3 4E-BP1
Symbols BP-1
4EBP1
4E-BP1
PHAS-I

Gene

PDB

1EJ4   1WKW   2JGB   2JGC   2V8W   2V8X   2V8Y   3HXG   3HXI   3M93   3M94   3U7X   4UED   5BXV   5EKV  

Gene RIF (131)

PMID Text
26832959 It was concluded that over-activation of the mTORC1/4E-BP1/p21 pathway is a frequent and clinically relevant alteration in head and neck squamous cell carcinomas.
26577921 Increased 4EBP1 abundance was a common feature in prostate cancer patients who had been treated with the PI3K pathway inhibitor BKM120; thus, 4EBP1 may be associated with drug resistance in human tumors
26427479 Results suggest that blocking both the mTOR kinase downstream targets 4E-BP1 protein and p70 S6 kinase 1, but not p70 S6 kinase 1 alone, prevents the migration of retinal pigment epithelium (RPE) cells.
26360779 Twist1 is correlated with p-4E-BP1 in predicting the prognostic outcome of NSCLC.
26305094 results suggest that respiratory syncytial virus is a virus that still contains unknown mechanisms involved in the translation of their mRNAs through the alteration or modification of some translation factors, such as 4EBP1, possibly to favor its replicative
26204490 eIF4E binding protein 1 expression has a role in clinical survival outcomes in colorectal cancer
26170285 the C-terminal extension (motif 3) is critical to 4E-BP1-mediated cell cycle arrest and it partially overlaps with the binding site of 4EGI-1
26097581 phosphorylation site affected the prognostic significance of 4EBP1 in non-small cell lung cancer.
25999352 Taken together, these results highlight the potential dependence of eIF4G overexpression and 4E-BP1 phosphorylation in CLL survival.
25883264 mitotic cap-dependent translation is generally sustained during mitosis by CDK1 phosphorylation of 4E-BP1 even under conditions of reduced mTOR signaling
More...

AA Sequence

MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKT      1 - 70
PPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI                           71 - 118
//

Text Mined References (198)

PMID Year Title
26832959 2016 Stabilization of p21 by mTORC1/4E-BP1 predicts clinical outcome of head and neck cancers.
26577921 2015 Cell type-specific abundance of 4EBP1 primes prostate cancer sensitivity or resistance to PI3K pathway inhibitors.
26427479 2016 The mTOR Kinase Inhibitor INK128 Blunts Migration of Cultured Retinal Pigment Epithelial Cells.
26360779 2015 Twist1-mediated 4E-BP1 regulation through mTOR in non-small cell lung cancer.
26305094 2015 4EBP1 Is Dephosphorylated by Respiratory Syncytial Virus Infection.
26204490 2015 eIF4E binding protein 1 expression is associated with clinical survival outcomes in colorectal cancer.
26170285 2015 Molecular mechanism of the dual activity of 4EGI-1: Dissociating eIF4G from eIF4E but stabilizing the binding of unphosphorylated 4E-BP1.
26097581 2015 Prognostic significance of phosphorylated 4E-binding protein 1 in non-small cell lung cancer.
25999352 2015 RPPA-based protein profiling reveals eIF4G overexpression and 4E-BP1 serine 65 phosphorylation as molecular events that correspond with a pro-survival phenotype in chronic lymphocytic leukemia.
25883264 2015 CDK1 substitutes for mTOR kinase to activate mitotic cap-dependent protein translation.
More...