Property Summary

NCBI Gene PubMed Count 15
PubMed Score 234.84
PubTator Score 24.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
medulloblastoma 1524 3.90759138082849E-8
lung adenocarcinoma 2714 3.00261579050592E-7
acute quadriplegic myopathy 1157 9.31554687151844E-7
ovarian cancer 8492 2.33744447610014E-6
medulloblastoma, large-cell 6234 2.40225114210258E-6
atypical teratoid / rhabdoid tumor 4369 9.07093090743074E-6
glioblastoma 5572 1.44525307295128E-4
psoriasis 6685 2.03304831274673E-4
primitive neuroectodermal tumor 3031 3.37882518761391E-4
osteosarcoma 7933 3.61095729372271E-4
Multiple myeloma 1328 9.28770700399912E-4
tuberculosis and treatment for 6 months 686 0.00116799807746954
adult high grade glioma 2148 0.00130394319529277
Rheumatoid Arthritis 1171 0.00933862190137191
astrocytic glioma 2241 0.018020244583204
Disease Target Count Z-score Confidence
Carbuncle 2 3.553 1.8
Lymph node tuberculosis 6 3.058 1.5

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.009
Multiple myeloma 1.451 0.001
astrocytic glioma -1.200 0.018
psoriasis -1.300 0.000
osteosarcoma -1.302 0.000
medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell -2.200 0.000
primitive neuroectodermal tumor -1.300 0.000
acute quadriplegic myopathy 1.266 0.000
tuberculosis and treatment for 6 months -1.600 0.001
adult high grade glioma -1.200 0.001
lung adenocarcinoma -1.100 0.000
ovarian cancer -1.800 0.000

Synonym

Accession Q13530 B4DUE9 O43717 Q9BR33
Symbols TDE
TDE1
AIGP1
TMS-1
DIFF33
SBBI99

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (4)

PMID Text
26439863 HIV-1 Nef counteracts restriction of HIV-1 replication by SERINC3 and SERINC5
26416733 SERINC3 and SERINC5 together restricted HIV-1 replication, and this restriction was evaded by Nef
26416733 HIV-1 Nef counteracts restriction of HIV-1 replication by SERINC3 and SERINC5
16547497 TDE1 inhibits apoptosis and stimulates tumorigenesis

AA Sequence

MGAVLGVFSLASWVPCLCSGASCLLCSCCPNSKNSTVTRLIYAFILLLSTVVSYIMQRKEMETYLKKIPG      1 - 70
FCEGGFKIHEADINADKDCDVLVGYKAVYRISFAMAIFFFVFSLLMFKVKTSKDLRAAVHNGFWFFKIAA     71 - 140
LIGIMVGSFYIPGGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFT    141 - 210
SAFYILSIICVGLLYTYYTKPDGCTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITLYTM    211 - 280
YLTWSAMSNEPDRSCNPNLMSFITRITAPTLAPGNSTAVVPTPTPPSKSGSLLDSDNFIGLFVFVLCLLY    281 - 350
SSIRTSTNSQVDKLTLSGSDSVILGDTTTSGASDEEDGQPRRAVDNEKEGVQYSYSLFHLMLCLASLYIM    351 - 420
MTLTSWYSPDAKFQSMTSKWPAVWVKISSSWVCLLLYVWTLVAPLVLTSRDFS                     421 - 473
//

Text Mined References (16)

PMID Year Title
26416734 2015 HIV-1 Nef promotes infection by excluding SERINC5 from virion incorporation.
26416733 2015 SERINC3 and SERINC5 restrict HIV-1 infectivity and are counteracted by Nef.
22925353 2013 A genome-wide association study of seasonal pattern mania identifies NF1A as a possible susceptibility gene for bipolar disorder.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16547497 2006 Human TDE1, a TDE1/TMS family member, inhibits apoptosis in vitro and stimulates in vivo tumorigenesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...