Property Summary

NCBI Gene PubMed Count 15
Grant Count 5
Funding $295,823.5
PubMed Score 234.84
PubTator Score 24.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.009
Multiple myeloma 1.451 0.001
astrocytic glioma -1.200 0.018
psoriasis -1.300 0.000
osteosarcoma -1.302 0.000
medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell -2.200 0.000
primitive neuroectodermal tumor -1.300 0.000
acute quadriplegic myopathy 1.266 0.000
tuberculosis and treatment for 6 months -1.600 0.001
adult high grade glioma -1.200 0.001
lung adenocarcinoma -1.100 0.000
ovarian cancer -1.800 0.000

Synonym

Accession Q13530 B4DUE9 O43717 Q9BR33
Symbols TDE
TDE1
AIGP1
TMS-1
DIFF33
SBBI99

Gene

Gene RIF (5)

PMID Text
26439863 HIV-1 Nef counteracts restriction of HIV-1 replication by SERINC3 and SERINC5
26416733 SERINC3 and SERINC5 together restricted HIV-1 replication, and this restriction was evaded by Nef
26416733 HIV-1 Nef counteracts restriction of HIV-1 replication by SERINC3 and SERINC5
26416733 HIV-1 Nef counteracts restriction of HIV-1 replication by SERINC3 and SERINC5
16547497 TDE1 inhibits apoptosis and stimulates tumorigenesis

AA Sequence

MGAVLGVFSLASWVPCLCSGASCLLCSCCPNSKNSTVTRLIYAFILLLSTVVSYIMQRKEMETYLKKIPG      1 - 70
FCEGGFKIHEADINADKDCDVLVGYKAVYRISFAMAIFFFVFSLLMFKVKTSKDLRAAVHNGFWFFKIAA     71 - 140
LIGIMVGSFYIPGGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFT    141 - 210
SAFYILSIICVGLLYTYYTKPDGCTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITLYTM    211 - 280
YLTWSAMSNEPDRSCNPNLMSFITRITAPTLAPGNSTAVVPTPTPPSKSGSLLDSDNFIGLFVFVLCLLY    281 - 350
SSIRTSTNSQVDKLTLSGSDSVILGDTTTSGASDEEDGQPRRAVDNEKEGVQYSYSLFHLMLCLASLYIM    351 - 420
MTLTSWYSPDAKFQSMTSKWPAVWVKISSSWVCLLLYVWTLVAPLVLTSRDFS                     421 - 473
//

Text Mined References (16)

PMID Year Title
26416734 2015 HIV-1 Nef promotes infection by excluding SERINC5 from virion incorporation.
26416733 2015 SERINC3 and SERINC5 restrict HIV-1 infectivity and are counteracted by Nef.
22925353 2013 A genome-wide association study of seasonal pattern mania identifies NF1A as a possible susceptibility gene for bipolar disorder.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16547497 2006 Human TDE1, a TDE1/TMS family member, inhibits apoptosis in vitro and stimulates in vivo tumorigenesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...