Property Summary

NCBI Gene PubMed Count 303
PubMed Score 515.27
PubTator Score 562.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.400 0.009
ependymoma -1.500 0.000
glioblastoma -1.600 0.000
medulloblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor -1.400 0.001
adult high grade glioma -1.800 0.000
pilocytic astrocytoma -1.400 0.000
ovarian cancer 1.100 0.001

Synonym

Accession Q13526 A8K4V9 Q53X75
Symbols DOD
UBL5

Gene

PANTHER Protein Class (1)

PDB

1F8A   1I6C   1I8G   1I8H   1NMV   1NMW   1PIN   1ZCN   2F21   2ITK   2KBU   2KCF   2LB3   2M8I   2M8J   2M9E   2M9F   2M9I   2M9J   2N1O   2Q5A   2RUC   2RUD   2RUQ   2RUR   2XP3   2XP4   2XP5   2XP6   2XP7   2XP8   2XP9   2XPA   2XPB   2ZQS   2ZQT   2ZQU   2ZQV   2ZR4   2ZR5   2ZR6   3I6C   3IK8   3IKD   3IKG   3JYJ   3KAB   3KAC   3KAD   3KAF   3KAG   3KAH   3KAI   3KCE   3NTP   3ODK   3OOB   3TC5   3TCZ   3TDB   3WH0   4GWT   4GWV   4QIB   4TNS   4TYO   4U84   4U85   4U86  

 GWAS Trait (1)

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
504536 confirmatory 20 / 131 / 1123 qHTS Validation Assay to Find Inhibitors of Pin1
504591 summary 0 / 0 / 0 Pin1 inhibitors: Summary
504891 confirmatory 34 / 22628 / 364905 qHTS Assay to Find Inhibitors of Pin1
624308 confirmatory 8 / 4 / 4 qHTS Assay to Find Inhibitors of Pin1: Hit Validation
624312 confirmatory 6 / 5 / 5 qHTS Assay to Find Inhibitors of Pin1: Hit Validation using Tamra Binding

Gene RIF (277)

PMID Text
26977025 The expression of PIN1 was associated with risk of malignancy, tumour location, tumour size, and mitotic counts in gastrointestinal stromal tumors.
26917410 Results indicate that PIN1 may be a valuable target to hit in cancer cells characterized by increased aggressive potential, overexpression of erbB receptor family members, and defective p53.
26874277 This shows that Pin1 is implemented in maintaining the susceptibility to the genotoxic drugs by controlling P-gp level as well as p53-dependent apoptosis and cell cycle signaling pathways.
26784107 Report shows that PIN1 binds to and stabilizes HIF-1alpha, consequently enhancing the angiogenesis.
26752745 Data show that Prolyl isomerase Pin1 is expressed in an epidermal growth factor receptor (EGFR)-mutant lung cancer tissue that has undergone partial epithelial-mesenchymal transition (EMT) and acquired resistance to EGFR tyrosine kinase inhibitors (TKIs).
26651388 the role of hydration in the structural integrity of Pin1
26461058 Pin1 knockdown in HCC cells inhibited the phosphorylation of NF-kappaB-p65(Ser276).
26456073 Structural Analysis of the Pin1-CPEB1 interaction and its potential role in CPEB1 degradation has been described.
26406962 The binding affinities of series of 4-substituted proline derivatives of phosphopeptides to the WW domain of Pin1 were investigated.
26387736 Results show that Pin1 down-regulates the mitochondrial activity of ATR through its isomerization from cis- to trans-isomers.
More...

AA Sequence

MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRP      1 - 70
SSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFA     71 - 140
LRTGEMSGPVFTDSGIHIILRTE                                                   141 - 163
//

Text Mined References (310)

PMID Year Title
26977025 2016 Expression of PIN1 in Gastrointestinal Stromal Tumours and its Clinical Significance.
26917410 Targeting peptidyl-prolyl isomerase pin1 to inhibit tumor cell aggressiveness.
26874277 2016 Prolyl isomerase Pin1 regulates doxorubicin-inducible P-glycoprotein level by reducing Foxo3 stability.
26784107 2016 Peptidyl Prolyl Isomerase PIN1 Directly Binds to and Stabilizes Hypoxia-Inducible Factor-1?.
26752745 2016 Prolyl isomerase Pin1 promotes survival in EGFR-mutant lung adenocarcinoma cells with an epithelial-mesenchymal transition phenotype.
26651388 2016 Conserved Hydration Sites in Pin1 Reveal a Distinctive Water Recognition Motif in Proteins.
26461058 2015 Pin1 facilitates NF-?B activation and promotes tumour progression in human hepatocellular carcinoma.
26456073 2015 Structural Analysis of the Pin1-CPEB1 interaction and its potential role in CPEB1 degradation.
26406962 2015 Modulating the Affinities of Phosphopeptides for the Human Pin1 WW Domain Using 4-Substituted Proline Derivatives.
26387736 2015 ATR Plays a Direct Antiapoptotic Role at Mitochondria, which Is Regulated by Prolyl Isomerase Pin1.
More...