Property Summary

Ligand Count 69
NCBI Gene PubMed Count 333
PubMed Score 522.83
PubTator Score 562.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.800 1.1e-05
astrocytic glioma -1.400 8.7e-03
Astrocytoma, Pilocytic -1.400 1.7e-06
atypical teratoid / rhabdoid tumor -1.900 1.9e-09
ependymoma -1.500 5.2e-13
glioblastoma -1.300 2.5e-08
group 4 medulloblastoma -1.400 1.2e-04
medulloblastoma, large-cell -1.700 6.2e-06
ovarian cancer 1.100 1.3e-03
primitive neuroectodermal tumor -1.400 5.2e-04

Synonym

Accession Q13526 A8K4V9 Q53X75
Symbols DOD
UBL5

Gene

PDB

1F8A   1I6C   1I8G   1I8H   1NMV   1NMW   1PIN   1ZCN   2F21   2ITK   2KBU   2KCF   2LB3   2M8I   2M8J   2M9E   2M9F   2M9I   2M9J   2N1O   2Q5A   2RUC   2RUD   2RUQ   2RUR   2XP3   2XP4   2XP5   2XP6   2XP7   2XP8   2XP9   2XPA   2XPB   2ZQS   2ZQT   2ZQU   2ZQV   2ZR4   2ZR5   2ZR6   3I6C   3IK8   3IKD   3IKG   3JYJ   3KAB   3KAC   3KAD   3KAF   3KAG   3KAH   3KAI   3KCE   3NTP   3ODK   3OOB   3TC5   3TCZ   3TDB   3WH0   4GWT   4GWV   4QIB   4TNS   4TYO   4U84   4U85   4U86   5B3W   5B3X   5B3Y   5B3Z   5BMY   5GPH   5UY9  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Protein-protein Interaction (10)

Gene RIF (303)

AA Sequence

MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRP      1 - 70
SSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFA     71 - 140
LRTGEMSGPVFTDSGIHIILRTE                                                   141 - 163
//

Text Mined References (341)

PMID Year Title