Property Summary

Ligand Count 2
NCBI Gene PubMed Count 29
PubMed Score 14.73
PubTator Score 24.34

Knowledge Summary

Patent (6,767)

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy 1.128 5.4e-04
Amyotrophic lateral sclerosis 1.042 7.2e-06
astrocytic glioma 1.100 4.1e-02
atypical teratoid / rhabdoid tumor 2.100 3.7e-06
dermatomyositis 1.400 8.5e-04
Down syndrome 1.100 2.8e-03
ependymoma 1.900 6.3e-03
Gaucher disease type 1 -1.500 8.8e-03
glioblastoma 1.400 1.3e-02
group 4 medulloblastoma 2.300 1.2e-03
hereditary spastic paraplegia -1.254 5.8e-03
intraductal papillary-mucinous adenoma (... 1.100 1.8e-02
intraductal papillary-mucinous carcinoma... 1.400 1.2e-02
lung adenocarcinoma 1.678 9.2e-06
medulloblastoma, large-cell -1.100 1.1e-02
oligodendroglioma 1.400 3.5e-02
osteosarcoma 2.236 6.1e-05
ovarian cancer 1.400 7.6e-04
pediatric high grade glioma 1.100 4.3e-02
Pick disease -1.100 4.0e-03
primitive neuroectodermal tumor 1.500 3.0e-05
progressive supranuclear palsy -1.700 2.1e-02
psoriasis 1.100 9.3e-04

Gene RIF (12)

AA Sequence

MAAAETQSLREQPEMEDANSEKSINEENGEVSEDQSQNKHSRHKKKKHKHRSKHKKHKHSSEEDKDKKHK      1 - 70
HKHKHKKHKRKEIIDASDKEGMSPAKRTKLDDLALLEDLEKQRALIKAELDNELMEGKVQSGMGLILQGY     71 - 140
ESGSEEEGEIHEKARNGNRSSTRSSSTKGKLELVDNKITTKKRSKSRSKERTRHRSDKKKSKGGIEIVKE    141 - 210
KTTRSKSKERKKSKSPSKRSKSQDQARKSKSPTLRRRSQEKIGKARSPTDDKVKIEDKSKSKDRKKSPII    211 - 280
NESRSRDRGKKSRSPVDLRGKSKDRRSRSKERKSKRSETDKEKKPIKSPSKDASSGKENRSPSRRPGRSP    281 - 350
KRRSLSPKPRDKSRRSRSPLLNDRRSKQSKSPSRTLSPGRRAKSRSLERKRREPERRRLSSPRTRPRDDI    351 - 420
LSRRERSKDASPINRWSPTRRRSRSPIRRRSRSPLRRSRSPRRRSRSPRRRDRGRRSRSRLRRRSRSRGG    421 - 490
RRRRSRSKVKEDKFKGSLSEGMKVEQESSSDDNLEDFDVEEEDEEALIEQRRIQRQAIVQKYKYLAEDSN    491 - 560
MSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAP    561 - 630
DMFTESDDMFAAYFDSARLRAAGIGKDFKENPNLRDNWTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSN    631 - 700
VVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPL    701 - 770
SMNLREVLKKYGKDVGLHIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILVNESKTILKLCDFGSASH    771 - 840
VADNDITPYLVSRFYRAPEIIIGKSYDYGIDMWSVGCTLYELYTGKILFPGKTNNHMLKLAMDLKGKMPN    841 - 910
KMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLL    911 - 980
DQILMLDPAKRISINQALQHAFIQEKI                                               981 - 1007
//

Text Mined References (49)

PMID Year Title