Property Summary

NCBI Gene PubMed Count 29
PubMed Score 14.15
PubTator Score 24.34

Knowledge Summary

Patent (6,767)

Expression

Synonym

Accession Q13523 A8K5C9 Q5D0F6 Q5TAY8 Q8IVC3 Q8TDP2 Q96QT7 Q9UEE6
Symbols PR4H
PRP4
PRP4H
PRP4K
dJ1013A10.1

Gene

PDB

4IAN   4IFC   4IIR   4IJP  

 Collection (1)

Gene RIF (12)

PMID Text
26712520 PRP4K is novel estrogen regulated kinase, and its levels can be reduced by 4-OHT in ER+ breast cancer cells altering their response to taxanes
25602630 PRP4K functions as a HER2-regulated modifier of taxane sensitivity that may have prognostic value as a marker of better overall survival in taxane-treated ovarian cancer patients.
25602630 PRP4K functions as a HER2-regulated modifier of taxane sensitivity and is a prognostic biomarker for better survival in taxane-treated ovarian cancer patients. PRP4K knock-down results in "mitotic slippage" in response to taxanes, and reduced PRP4K expression is associated with both intrinsic and acquired resistance of ovarian and breast cancers to taxanes.
23686430 expression and activity are closely associated with the survival and regulation of apoptotic events in colon cancer cells
23466643 data indicate that miR-371-5p, which is highly expressed in hepatocellular carcinoma, promotes the growth of HCC cells in vitro and in vivo by activating cell cycle progression at the G1/S checkpoint by directly targeting PRPF4B
22944692 HIV-1 Rev interacting protein, pre-mRNA processing factor 4 homolog B (PRPF4B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with PRPF4B is increased by RRE
22174317 HIV-1 Rev interacting protein, pre-mRNA processing factor 4 homolog B (PRPF4B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with PRPF4B is increased by RRE
20118938 The authors provide evidence that PRP6 and PRP31 are directly phosphorylated by human PRP4 kinase (PRP4K) concomitant with their incorporation into B complexes.
19902070 Short-term exercise resulted in a significant increase of mRNA expression of genes encoding proteins involved in the formation of precatalytic splisosome: PRPF4B.
17513757 PRP4, a serine/threonine protein kinase, is identified as a Kruppel-like factor 13 (KLF13)-binding protein; PRP4 phosphorylates KLF13
More...

AA Sequence

MAAAETQSLREQPEMEDANSEKSINEENGEVSEDQSQNKHSRHKKKKHKHRSKHKKHKHSSEEDKDKKHK      1 - 70
HKHKHKKHKRKEIIDASDKEGMSPAKRTKLDDLALLEDLEKQRALIKAELDNELMEGKVQSGMGLILQGY     71 - 140
ESGSEEEGEIHEKARNGNRSSTRSSSTKGKLELVDNKITTKKRSKSRSKERTRHRSDKKKSKGGIEIVKE    141 - 210
KTTRSKSKERKKSKSPSKRSKSQDQARKSKSPTLRRRSQEKIGKARSPTDDKVKIEDKSKSKDRKKSPII    211 - 280
NESRSRDRGKKSRSPVDLRGKSKDRRSRSKERKSKRSETDKEKKPIKSPSKDASSGKENRSPSRRPGRSP    281 - 350
KRRSLSPKPRDKSRRSRSPLLNDRRSKQSKSPSRTLSPGRRAKSRSLERKRREPERRRLSSPRTRPRDDI    351 - 420
LSRRERSKDASPINRWSPTRRRSRSPIRRRSRSPLRRSRSPRRRSRSPRRRDRGRRSRSRLRRRSRSRGG    421 - 490
RRRRSRSKVKEDKFKGSLSEGMKVEQESSSDDNLEDFDVEEEDEEALIEQRRIQRQAIVQKYKYLAEDSN    491 - 560
MSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAP    561 - 630
DMFTESDDMFAAYFDSARLRAAGIGKDFKENPNLRDNWTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSN    631 - 700
VVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPL    701 - 770
SMNLREVLKKYGKDVGLHIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILVNESKTILKLCDFGSASH    771 - 840
VADNDITPYLVSRFYRAPEIIIGKSYDYGIDMWSVGCTLYELYTGKILFPGKTNNHMLKLAMDLKGKMPN    841 - 910
KMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLL    911 - 980
DQILMLDPAKRISINQALQHAFIQEKI                                               981 - 1007
//

Text Mined References (48)

PMID Year Title
26712520 2016 Estrogen receptor alpha (ESR1)-signaling regulates the expression of the taxane-response biomarker PRP4K.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25602630 2015 PRP4K is a HER2-regulated modifier of taxane sensitivity.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23686430 2013 Curcumin induces apoptosis in human colorectal carcinoma (HCT-15) cells by regulating expression of Prp4 and p53.
23466643 2013 miR-371-5p down-regulates pre mRNA processing factor 4 homolog B (PRPF4B) and facilitates the G1/S transition in human hepatocellular carcinoma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...