Property Summary

NCBI Gene PubMed Count 13
PubMed Score 53.49
PubTator Score 366.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 7.10111811392593E-17
pilocytic astrocytoma 3086 2.15726613905863E-12
glioblastoma 5572 2.97151129479177E-9
juvenile dermatomyositis 1189 4.60884528654845E-8
pediatric high grade glioma 2712 1.91991455876273E-7
medulloblastoma, large-cell 6234 2.9215934702593E-7
acute quadriplegic myopathy 1157 3.0787374725988E-7
sonic hedgehog group medulloblastoma 1482 8.06224651777081E-6
psoriasis 6685 4.35253161028841E-5
atypical teratoid / rhabdoid tumor 4369 1.69961032011344E-4
ductal carcinoma in situ 1745 2.6261851615988E-4
colon cancer 1475 7.18864156887234E-4
pancreatic cancer 2300 0.00178326602032138
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00382861040249497
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00923402893255943
Atopic dermatitis 944 0.00946107655492536
invasive ductal carcinoma 2950 0.0120784198505227
astrocytic glioma 2241 0.0156606912715577
primitive neuroectodermal tumor 3031 0.0162442637343862
non primary Sjogren syndrome sicca 840 0.0165242207581517
ependymoma 2514 0.0339159929107225
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0474180165251857

Expression

Synonym

Accession Q13522 Q6IB01 Q8TBJ2 Q8WWV2
Symbols I1
IPP1

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Xenopus EggNOG Inparanoid

Gene RIF (8)

PMID Text
26455482 These findings suggest that the human G109E inhibitor-1 variant impairs sarcoplasmic reticulum Ca-cycling and promotes arrhythmogenesis under stress conditions.
24249716 I-1 and sarco/endoplasmic reticulum Ca2+ -ATPase synergistically induce the vascular smooth muscle cell contractile phenotype.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18698139 the human inhibitor-1 G147D polymorphism, found almost exclusively in blacks, may act as a modifier rather than risk factor in heart failure development
18698139 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18192322 G147D PPI-1 can attenuate responses of cardiomyocytes to beta-adrenergic agonists by decreasing PLN phosphorylation and therefore may contribute to deteriorated function in heart failure.
15345721 multiple domains in I-1 target cellular PP1 complexes, and I-1 has a role as a cellular regulator of eIF2alpha phosphorylation

AA Sequence

MEQDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPHLKSTLAMSPRQ      1 - 70
RKKMTRITPTMKELQMMVEHHLGQQQQGEEPEGAAESTETQESRPPGIPDTEVESRLGTSGTAKKTAECI     71 - 140
PKTHERGSKEPSTKEPSTHIPPLDSKGANSV                                           141 - 171
//

Text Mined References (14)

PMID Year Title
26455482 2015 Human G109E-inhibitor-1 impairs cardiac function and promotes arrhythmias.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24249716 2014 Synergistic role of protein phosphatase inhibitor 1 and sarco/endoplasmic reticulum Ca2+ -ATPase in the acquisition of the contractile phenotype of arterial smooth muscle cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18698139 2009 The human G147D-protein phosphatase 1 inhibitor-1 polymorphism is not associated with altered clinical characteristics in heart failure.
18192322 2008 A human polymorphism of protein phosphatase-1 inhibitor-1 is associated with attenuated contractile response of cardiomyocytes to beta-adrenergic stimulation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345721 2004 The inhibitor-1 C terminus facilitates hormonal regulation of cellular protein phosphatase-1: functional implications for inhibitor-1 isoforms.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...