Property Summary

NCBI Gene PubMed Count 13
PubMed Score 55.16
PubTator Score 366.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
acute quadriplegic myopathy -2.339 3.1e-07
adult high grade glioma -2.400 9.0e-08
astrocytic glioma -1.500 1.6e-02
Astrocytoma, Pilocytic -3.100 1.2e-12
Atopic dermatitis -1.600 9.5e-03
atypical teratoid / rhabdoid tumor -2.200 1.7e-04
breast carcinoma -1.700 2.7e-03
colon cancer -1.400 7.2e-04
ductal carcinoma in situ -3.500 2.6e-04
ependymoma -1.200 3.4e-02
glioblastoma -2.700 3.0e-09
group 3 medulloblastoma -2.600 2.0e-04
intraductal papillary-mucinous adenoma (... -1.300 3.8e-03
intraductal papillary-mucinous neoplasm ... -1.100 4.7e-02
invasive ductal carcinoma -3.900 1.2e-02
juvenile dermatomyositis -1.064 4.6e-08
medulloblastoma, large-cell -2.300 2.9e-07
non primary Sjogren syndrome sicca 1.300 1.7e-02
pancreatic cancer -1.100 1.8e-03
pancreatic ductal adenocarcinoma liver m... -2.218 1.3e-03
primitive neuroectodermal tumor -1.400 1.6e-02
psoriasis -1.400 4.1e-03

Gene RIF (8)

AA Sequence

MEQDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPHLKSTLAMSPRQ      1 - 70
RKKMTRITPTMKELQMMVEHHLGQQQQGEEPEGAAESTETQESRPPGIPDTEVESRLGTSGTAKKTAECI     71 - 140
PKTHERGSKEPSTKEPSTHIPPLDSKGANSV                                           141 - 171
//

Text Mined References (14)

PMID Year Title