Property Summary

NCBI Gene PubMed Count 8
Grant Count 62
R01 Count 30
Funding $12,609,936
PubMed Score 31.43
PubTator Score 19.03

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession Q13520 AQP-6
Symbols KID
AQP2L

Gene

PANTHER Protein Class (1)

PDB

1S6E  

Gene RIF (4)

PMID Text
26779650 AQP6 and AQP8 had different expression degrees in epithelial ovarian tissues, which suggests that AQP6 and AQP8 may play certain roles in epithelial ovarian tumors.
20461409 Expression of AQP1, AQP4, or AQP6 mRNA did not differ in vestibular endorgans from patients with Meniere's disease.
19680475 Data have identified AQP6 s valuable markers for renal oncocytomas.
12177001 the primary role of AQP6 may be in cellular regulation

AA Sequence

MDAVEPGGRGWASMLACRLWKAISRALFAEFLATGLYVFFGVGSVMRWPTALPSVLQIAITFNLVTAMAV      1 - 70
QVTWKASGAHANPAVTLAFLVGSHISLPRAVAYVAAQLVGATVGAALLYGVMPGDIRETLGINVVRNSVS     71 - 140
TGQAVAVELLLTLQLVLCVFASTDSRQTSGSPATMIGISVALGHLIGIHFTGCSMNPARSFGPAIIIGKF    141 - 210
TVHWVFWVGPLMGALLASLIYNFVLFPDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEME    211 - 280
SV                                                                        281 - 282
//

Text Mined References (9)

PMID Year Title
26779650 2016 Expression of AQP6 and AQP8 in epithelial ovarian tumor.
20461409 2010 Immunohistochemical localization and mRNA expression of aquaporins in the macula utriculi of patients with Meniere's disease and acoustic neuroma.
19680475 2009 Gene expression profiling of chromophobe renal cell carcinomas and renal oncocytomas by Affymetrix GeneChip using pooled and individual tumours.
16541075 2006 The finished DNA sequence of human chromosome 12.
12522663 2003 Aquaporin expression in developing human teeth and selected orofacial tissues.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12177001 2002 Characterization of aquaporin-6 as a nitrate channel in mammalian cells. Requirement of pore-lining residue threonine 63.
9268644 1997 Closely spaced tandem arrangement of AQP2, AQP5, and AQP6 genes in a 27-kilobase segment at chromosome locus 12q13.
8812490 1996 cDNA cloning and gene structure of a novel water channel expressed exclusively in human kidney: evidence for a gene cluster of aquaporins at chromosome locus 12q13.