Property Summary

NCBI Gene PubMed Count 8
PubMed Score 32.67
PubTator Score 19.03

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (4)

AA Sequence

MDAVEPGGRGWASMLACRLWKAISRALFAEFLATGLYVFFGVGSVMRWPTALPSVLQIAITFNLVTAMAV      1 - 70
QVTWKASGAHANPAVTLAFLVGSHISLPRAVAYVAAQLVGATVGAALLYGVMPGDIRETLGINVVRNSVS     71 - 140
TGQAVAVELLLTLQLVLCVFASTDSRQTSGSPATMIGISVALGHLIGIHFTGCSMNPARSFGPAIIIGKF    141 - 210
TVHWVFWVGPLMGALLASLIYNFVLFPDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEME    211 - 280
SV                                                                        281 - 282
//

Text Mined References (9)

PMID Year Title