Property Summary

NCBI Gene PubMed Count 97
PubMed Score 674.60
PubTator Score 376.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
posterior fossa group B ependymoma -2.300 2.2e-12
oligodendroglioma -1.300 9.3e-15
astrocytoma -1.200 2.4e-20
glioblastoma -1.300 1.9e-03
group 3 medulloblastoma -2.700 2.3e-04
periodontitis 1.500 1.9e-23
medulloblastoma, large-cell -2.100 8.6e-04
interstitial cystitis 3.000 2.7e-05
pediatric high grade glioma -1.200 2.9e-02
pilocytic astrocytoma -2.100 1.3e-06
primary Sjogren syndrome 1.200 9.8e-04
ulcerative colitis 1.800 5.3e-04
ovarian cancer 1.800 1.2e-02
psoriasis 1.900 4.6e-15

 GWAS Trait (1)

Gene RIF (32)

PMID Text
26349406 Study presents evidence suggesting that the PNOC and OPRL1 are dysregulated in suicide completers, thereby potentially contributing to impaired emotional and behavioral control and, ultimately, to the suicidal crisis
26233486 findings suggest that SNPs in opioid receptors and the PNOC genes are associated with NAS severity.
25677778 Data suggest that nociceptin/nociceptin receptor signaling in neurons of the hippocampus modulate learning and memory. [REVIEW]
25677777 Data suggest that interaction between the nociceptin/nociceptin receptor system and the orexin/orexin receptor system in neurons of the hypothalamus positively and negatively modulate complex and integrated responses to stress. [REVIEW]
25677776 Data suggest that the nociceptin/nociceptin receptor system is involved in modulation of psychological and inflammatory stress responses and in pathogenesis of anxiety. [REVIEW]
25677775 Data suggest that the nociceptin/nociceptin receptor system is involved in modulation of the immune response and in pathogenesis of autoimmune diseases. [REVIEW]
25677774 Data suggest that both nociceptin and nocistatin inhibit myometrial contractions and may play roles in perception of pain during delivery. [REVIEW]
25677773 Opioid neuropeptide systems are important mediators of ovarian steroid signaling that regulate reproduction in female; data suggest that nociceptin and nociceptin receptor system in arcuate nucleus of hypothalamus is such a system. [REVIEW]
25677772 Data suggest that nociceptin plays a crucial role in progress of meiosis during spermatogenesis. [REVIEW]
25677768 Data suggest that nociceptin and nociceptin receptor evolved as one of 4 opioid receptor systems in vertebrates; this system exhibits both analgesic and hyperalgesic effects. [REVIEW]
23454174 REVIEW: intracellular localization and physiological role of nociceptin and nocistatin
22706982 Strong expression of PNOC was seen in neoplastic neurons of 7/7 brainstem gangliogliomas, but was significantly weaker in non-brainstem GGs.
21744319 The presence of Orphanin, Oxytocin, ANP, eNOS and iNOS proteins was identified in the human umbilical cord.[Orphanin]
21600132 A high expression of nociceptin in adenomyosis may be one of the casual factors of dysmenorrhea. The severity of dysmenorrhea is positively correlated with the expression of nociceptin in eutopic endometrial tissue.
21547539 activation of NFkappaB by OFQ/Nociceptin suggests a likely mechanism for its modulation of the central nervous and immune systems.
21310194 chronic ischemic conditions of atherosclerotic origin are associated with significantly lower plasma nociceptin levels
20888736 PNOC expression level was 2.99 times higher in vitiligo involved skin when compared to healthy control skin.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20100531 Results showed that vigorous and prolonged hyperventilation changes plasma nociceptin/orphanin FQ levels due to the direct effects of hypocapnic alkalosis or to different sympatho-adrenergic system responses.
19874574 Observational study of gene-disease association. (HuGE Navigator)
19573600 data obtained from neocortex of epileptic patients provide strong evidence that temporal lobe epilepsy is associated with alterations in mu opioid and nociceptin receptor binding and signal transduction mechanisms downstream of these receptors
19560501 Unstable angina is associated with a significant increase in circulating nociceptin/orphanin FQ levels unrelated to intervening transient myocardial ischemia or hemodynamic changes.
19501074 Our results support the concept postulating that chronic ethanol consumption and withdrawal downregulate the PNOC/OPRL1 system, which critically controls alcohol intake.
19058789 Observational study of gene-disease association. (HuGE Navigator)
18292431 Peripheral blood mononuclear cells transcribe pre-pro-nociception/orphaninFQ.
17910740 Two SNPs in PNOC showed marginal association with alcoholism and one with illicit drug dependence.
17910740 Observational study of gene-disease association. (HuGE Navigator)
16043263 The presence of two different forms of mature nocistatin (NST-17 and NST-30) and a possible N-terminal methionine cleaved NST-29 have been confirmed by both radioimmunoassay and mass spectrometry.
12950177 results show that nociceptin/NociR is present and functional in human neutrophils, and the results identify a novel dialogue pathway between neural and immune tissues
12812047 Peripheral blood levels are elevated in Wilson disease
11501941 Observational study of gene-disease association. (HuGE Navigator)
11436130 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKVLLCDLLLLSLFSSVFSSCQRDCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTPCTKVMARSSW      1 - 70
QLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSA     71 - 140
RKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV                                      141 - 176
//

Text Mined References (98)

PMID Year Title
26349406 2015 Decreased expression of nociceptin/orphanin FQ in the dorsal anterior cingulate cortex of suicides.
26233486 2015 Variations in opioid receptor genes in neonatal abstinence syndrome.
25716007 2015 Structure activity studies of nociceptin/orphanin FQ(1-13)-NH2 derivatives modified in position 5.
25677778 2015 Nociceptin/orphanin-FQ modulation of learning and memory.
25677777 2015 The neuronal circuit between nociceptin/orphanin FQ and hypocretins/orexins coordinately modulates stress-induced analgesia and anxiety-related behavior.
25677776 2015 Endogenous nociceptin system involvement in stress responses and anxiety behavior.
25677775 2015 Nociceptin/orphanin FQ-NOP receptor system in inflammatory and immune-mediated diseases.
25677774 2015 Effects of nociceptin and nocistatin on uterine contraction.
25677773 2015 Orphanin FQ-ORL-1 regulation of reproduction and reproductive behavior in the female.
25677772 2015 Nociceptin and meiosis during spermatogenesis in postnatal testes.
25677768 2015 Bioinformatics and evolution of vertebrate nociceptin and opioid receptors.
24228146 2013 Plasma concentrations of nociceptin/orphanin FQ: comparison of levels after general and neuraxial anesthesia for arthroscopic knee surgery.
24189487 2014 The biology of Nociceptin/Orphanin FQ (N/OFQ) related to obesity, stress, anxiety, mood, and drug dependence.
24124588 2013 The Nociceptin/Orphanin FQ system is modulated in patients admitted to ICU with sepsis and after cardiopulmonary bypass.
24066107 2013 Inflammatory mediators influence the expression of nociceptin and its receptor in human whole blood cultures.
23454174 2013 Deciphering intracellular localization and physiological role of nociceptin and nocistatin.
23395957 2013 Cellular mechanisms of nociceptin/orphanin FQ (N/OFQ) peptide (NOP) receptor regulation and heterologous regulation by N/OFQ.
22706982 2012 Pediatric brainstem gangliogliomas show overexpression of neuropeptide prepronociceptin (PNOC) by microarray and immunohistochemistry.
21744319 2011 Human umbilical cord expresses several vasoactive peptides involved in the local regulation of vascular tone: protein and gene expression of Orphanin, Oxytocin, ANP, eNOS and iNOS.
21600132 2011 [Expression of orphanin in adenomyosis and its relationship with dysmenorrhea].
21547539 2011 Orphanin FQ/nociceptin activates nuclear factor kappa B.
21324928 2011 Expression of the nociceptin precursor and nociceptin receptor is modulated in cancer and septic patients.
21310194 2011 Plasma nociceptin/orphanin FQ levels are lower in patients with chronic ischemic cardiovascular diseases--A pilot study.
21079395 2010 Extensive changes in the expression of the opioid genes between humans and chimpanzees.
20888736 2010 Analysis of the expression profile of CRH-POMC system genes in vitiligo skin biopsies.
20589874 2010 Brain interstitial nociceptin/orphanin FQ levels are elevated in Parkinson's disease.
20413378 2010 Assessment of nociceptin/orphanin FQ and micro-opioid receptor mRNA in the human right atrium.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20100531 2010 Plasma nociceptin/orphanin FQ levels in response to the hyperventilation test in healthy subjects.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19573600 2009 Temporal lobe epilepsy causes selective changes in mu opioid and nociceptin receptor binding and functional coupling to G-proteins in human temporal neocortex.
19560501 2009 Plasma nociceptin/orphanin FQ levels rise after spontaneous episodes of angina, but not during induced myocardial ischemia.
19501074 2009 Expression of pronociceptin and its receptor is downregulated in the brain of human alcoholics.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18292431 2008 Human peripheral blood mononuclear cells produce pre-pro-nociceptin/orphanin FQ mRNA.
18247127 2008 Suppression of CCL2/MCP-1 and CCL5/RANTES expression by nociceptin in human monocytes.
17910740 2008 Association analysis of genes encoding the nociceptin receptor (OPRL1) and its endogenous ligand (PNOC) with alcohol or illicit drug dependence.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16043263 2006 Identification of mature nocistatin and nociceptin in human brain and cerebrospinal fluid by mass spectrometry combined with affinity chromatography and HPLC.
16042989 2005 Nociceptin/orphanin FQ inhibits electrically induced contractions of the human bronchus via NOP receptor activation.
15922491 2005 Nociceptin/orphanin FQ stimulates human monocyte chemotaxis via NOP receptor activation.
15773823 2005 Plasma nociceptin levels are reduced in migraine without aura.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15351928 2004 Nociceptin inhibits vanilloid TRPV-1-mediated neurosensitization induced by fenoterol in human isolated bronchi.
15030536 2004 Circulating nociceptin levels during the cluster headache period.
15020071 2004 Nociceptin/orphanin FQ modulates human T cell function in vitro.
14970396 2004 Biostable aptamers with antagonistic properties to the neuropeptide nociceptin/orphanin FQ.
14715146 2004 Distribution of nociceptin/orphanin FQ in adult human brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14695788 2004 Rising plasma nociceptin level during development of HCC: a case report.
14695766 2004 Increased nociceptin/orphanin FQ plasma levels in hepatocellular carcinoma.
12950177 2003 Human neutrophils as a source of nociceptin: a novel link between pain and inflammation.
12812047 2002 [Peripheral nociceptin levels in Wilson disease].
12736013 2003 Urodynamic effects of intravesical nociceptin/orphanin FQ in neurogenic detrusor overactivity: a randomized, placebo-controlled, double-blind study.
12576178 2003 Nociceptin immunoreactivity and receptor mRNA in the human trigeminal ganglion.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12371703 2002 Solution structure of nociceptin peptides.
12352616 2002 Quantitative analysis of nociceptin in blood of patients with acute and chronic pain.
12225892 2002 Novel orphanin FQ/nociceptin transcripts are expressed in human immune cells.
12217418 2002 Does nociceptin play a role in pain disorders in man?
12128158 2002 Elevated plasma nociceptin level in patients with Wilson disease.
12062800 2002 Regulation of transcription of the human prepronociceptin gene by Sp1.
11855841 2002 Regulation of cyclic AMP-dependent response element-binding protein (CREB) by the nociceptin/orphanin FQ in human dopaminergic SH-SY5Y cells.
11719021 2001 Expression of orphanin FQ and the opioid receptor-like (ORL1) receptor in the developing human and rat brain.
11696742 2001 Urodynamic and clinical evidence of acute inhibitory effects of intravesical nociceptin/orphanin FQ on detrusor overactivity in humans: a pilot study.
11568656 2001 Nociceptin-induced internalization of the ORL1 receptor in human neuroblastoma cells.
11501941 2001 Association analysis of polymorphisms in the prepronociceptin gene and schizophrenia.
11436130 2001 Genetic association studies of schizophrenia using the 8p21-22 genes: prepronociceptin (PNOC), neuronal nicotinic cholinergic receptor alpha polypeptide 2 (CHRNA2) and arylamine N-acetyltransferase 1 (NAT1).
11403992 2001 Orphanin FQ/nociceptin binds to functionally coupled ORL1 receptors on human immune cell lines and alters peripheral blood mononuclear cell proliferation.
11331401 2001 Differential splicing of transcripts encoding the orphanin FQ/nociceptin precursor.
11318773 2001 Effects of nociceptin and endomorphin 1 on the electrically stimulated human vas deferens.
11214319 2001 Molecular phylogenetics and the origins of placental mammals.
11165763 2001 Orphanin FQ/nociceptin and naloxone benzoylhydrazone activate distinct receptors in BE(2)-C human neuroblastoma cells.
11097863 2000 Highly potent nociceptin analog containing the Arg-Lys triple repeat.
11027536 2000 Transcriptional regulation of the human prepronociceptin gene.
10998544 2000 Nocistatin: a novel neuropeptide encoded by the gene for the nociceptin/orphanin FQ precursor.
10812065 2000 Pain peptides. Solution structure of orphanin FQ2.
10692489 2000 Functional inactivation of the nociceptin receptor by alanine substitution of glutamine 286 at the C terminus of transmembrane segment VI: evidence from a site-directed mutagenesis study of the ORL1 receptor transmembrane-binding domain.
10655922 1999 Neither nociceptin nor its receptor are present in human synovial fluid or tissue.
10570970 1999 The promoter region of human prepro-nociceptin gene and its regulation by cyclic AMP and steroid hormones.
10419552 1999 Agonistic effect of buprenorphine in a nociceptin/OFQ receptor-triggered reporter gene assay.
10380976 1999 Identification of human, rat and mouse nocistatin in brain and human nocistatin in brain and human cerebrospinal fluid.
10101606 1998 [Cloning of prepronociceptin has led to the discovery of other biologically active peptides].
10082806 1999 Biotransformation of nociceptin/orphanin FQ by enzyme activity from morphine-naive and morphine-treated cell cultures.
10025089 1998 Plasma levels on nociceptin in female fibromyalgia syndrome patients.
9822213 1998 Identification of nociceptin in human cerebrospinal fluid: comparison of levels in pain and non-pain states.
9559929 1998 Attenuation of nociceptin/orphanin FQ-induced signaling by N-methyl-D-aspartate in neuronal cells.
9521621 1998 Distribution of nociceptin/orphanin FQ receptor transcript in human central nervous system and immune cells.
9521323 1998 Nocistatin, a peptide that blocks nociceptin action in pain transmission.
9409745 1997 Comparison of the structure-activity relationships of nociceptin and dynorphin A using chimeric peptides.
9262184 1997 Presence and characterization of nociceptin (orphanin FQ) receptor binding in adult rat and human fetal hypothalamus.
9257731 1997 Nociceptin/orphanin FQ stimulates extracellular acidification and desensitization of the response involves protein kinase C.
9168905 1997 Solution conformation of nociceptin.
8844779 1996 Nociceptin in vitro biotransformation in human blood.
8735615 1996 The effect of nociceptin on Ca2+ channel current and intracellular Ca2+ in the SH-SY5Y human neuroblastoma cell line.
8710930 1996 Primary structure and tissue distribution of the orphanin FQ precursor.
8710928 1996 Structure, tissue distribution, and chromosomal localization of the prepronociceptin gene.
8662940 1996 Structure-activity relationship studies on the novel neuropeptide orphanin FQ.