Property Summary

NCBI Gene PubMed Count 97
Grant Count 245
R01 Count 186
Funding $43,769,808.05
PubMed Score 674.60
PubTator Score 376.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
posterior fossa group B ependymoma -2.300 0.000
oligodendroglioma -1.300 0.000
astrocytoma -1.200 0.000
glioblastoma -1.300 0.002
group 3 medulloblastoma -2.700 0.000
periodontitis 1.500 0.000
medulloblastoma, large-cell -2.100 0.001
interstitial cystitis 3.000 0.000
pediatric high grade glioma -1.200 0.029
pilocytic astrocytoma -2.100 0.000
primary Sjogren syndrome 1.200 0.001
ulcerative colitis 1.800 0.001
ovarian cancer 1.800 0.012
psoriasis 1.900 0.000

Synonym

Accession Q13519 B7Z749 Q6FH16
Symbols NOP
OFQ
N/OFQ
PPNOC
ppN/OFQ

Gene

Gene RIF (32)

PMID Text
26349406 Study presents evidence suggesting that the PNOC and OPRL1 are dysregulated in suicide completers, thereby potentially contributing to impaired emotional and behavioral control and, ultimately, to the suicidal crisis
26233486 findings suggest that SNPs in opioid receptors and the PNOC genes are associated with NAS severity.
25677778 Data suggest that nociceptin/nociceptin receptor signaling in neurons of the hippocampus modulate learning and memory. [REVIEW]
25677777 Data suggest that interaction between the nociceptin/nociceptin receptor system and the orexin/orexin receptor system in neurons of the hypothalamus positively and negatively modulate complex and integrated responses to stress. [REVIEW]
25677776 Data suggest that the nociceptin/nociceptin receptor system is involved in modulation of psychological and inflammatory stress responses and in pathogenesis of anxiety. [REVIEW]
25677775 Data suggest that the nociceptin/nociceptin receptor system is involved in modulation of the immune response and in pathogenesis of autoimmune diseases. [REVIEW]
25677774 Data suggest that both nociceptin and nocistatin inhibit myometrial contractions and may play roles in perception of pain during delivery. [REVIEW]
25677773 Opioid neuropeptide systems are important mediators of ovarian steroid signaling that regulate reproduction in female; data suggest that nociceptin and nociceptin receptor system in arcuate nucleus of hypothalamus is such a system. [REVIEW]
25677772 Data suggest that nociceptin plays a crucial role in progress of meiosis during spermatogenesis. [REVIEW]
25677768 Data suggest that nociceptin and nociceptin receptor evolved as one of 4 opioid receptor systems in vertebrates; this system exhibits both analgesic and hyperalgesic effects. [REVIEW]
More...

AA Sequence

MKVLLCDLLLLSLFSSVFSSCQRDCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTPCTKVMARSSW      1 - 70
QLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSA     71 - 140
RKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV                                      141 - 176
//

Text Mined References (98)

PMID Year Title
26349406 2015 Decreased expression of nociceptin/orphanin FQ in the dorsal anterior cingulate cortex of suicides.
26233486 2015 Variations in opioid receptor genes in neonatal abstinence syndrome.
25716007 2015 Structure activity studies of nociceptin/orphanin FQ(1-13)-NH2 derivatives modified in position 5.
25677778 2015 Nociceptin/orphanin-FQ modulation of learning and memory.
25677777 2015 The neuronal circuit between nociceptin/orphanin FQ and hypocretins/orexins coordinately modulates stress-induced analgesia and anxiety-related behavior.
25677776 2015 Endogenous nociceptin system involvement in stress responses and anxiety behavior.
25677775 2015 Nociceptin/orphanin FQ-NOP receptor system in inflammatory and immune-mediated diseases.
25677774 2015 Effects of nociceptin and nocistatin on uterine contraction.
25677773 2015 Orphanin FQ-ORL-1 regulation of reproduction and reproductive behavior in the female.
25677772 2015 Nociceptin and meiosis during spermatogenesis in postnatal testes.
More...