Property Summary

NCBI Gene PubMed Count 62
PubMed Score 420.47
PubTator Score 214.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.200 5.8e-05
Astrocytoma, Pilocytic 2.500 8.7e-07
atypical teratoid / rhabdoid tumor -1.700 6.9e-03
Down syndrome 1.300 3.3e-03
ependymoma -1.600 5.2e-03
glioblastoma 1.500 1.6e-02
group 3 medulloblastoma -2.500 9.1e-04
oligodendroglioma 2.700 1.5e-02
pediatric high grade glioma 1.400 1.4e-02
Pick disease -1.500 8.9e-05
psoriasis -1.200 7.1e-03
subependymal giant cell astrocytoma -2.427 4.2e-02
tuberculosis -3.200 2.1e-08

 GO Component (2)

Gene RIF (51)

AA Sequence

MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKL      1 - 70
GGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHG     71 - 140
PSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPAAAAH    141 - 210
AAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSG    211 - 280
ASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSLPRLTSDAK                               281 - 323
//

Text Mined References (62)

PMID Year Title