Property Summary

NCBI Gene PubMed Count 55
Grant Count 174
R01 Count 90
Funding $25,274,701.48
PubMed Score 385.62
PubTator Score 214.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Down syndrome 1.300 0.003
oligodendroglioma 2.700 0.015
astrocytoma 1.200 0.000
posterior fossa group A ependymoma -1.900 0.001
glioblastoma 1.600 0.004
group 3 medulloblastoma -2.500 0.001
atypical teratoid/rhabdoid tumor -1.800 0.000
tuberculosis -3.200 0.000
pediatric high grade glioma 1.400 0.014
pilocytic astrocytoma 2.800 0.000
subependymal giant cell astrocytoma -2.427 0.042
Pick disease -1.500 0.000
psoriasis -1.200 0.007

Synonym

Accession Q13516 B3KRF3 Q05BP9 Q49AL3 Q86X04 Q9NZ14 Oligo2
Symbols BHLHB1
OLIGO2
RACK17
PRKCBP2
bHLHe19

Gene

PANTHER Protein Class (2)

 GO Component (2)

Gene RIF (44)

PMID Text
26287936 Olig2 was positive in 5 out of 44 ependymomas (11%) and 50 out of 54 (93%) non-ependymal tumors
26271930 The present study is the first to verify the associations of SNPs rs762178, rs1059004, and rs9653711 of the OLIG2 gene with OCD in a Chinese Han population. Thus, OLIG2 might serve as a potential target for OCD treatment
25966902 The results demonstrate that the expression of Olig2 in dental pulp stem cells reduces the expression of stem cell markers and induces the development of oligodendrocyte progenitors.
25384509 OLIG2 is the most specific GSC marker.
25085214 High Olig2 expression is associated with oligodendrogliomas.
24821492 Our study suggests that CGT expression is controlled by balanced expression of the negative modulator OLIG2 and positive regulator Nkx2.2, providing new insights into how expression of GalCer is tightly regulated in cell-type- and stage-specific manners.
24395742 Authors investigated the role of Pten in these two critical cellular compartments in adult and developing brains using methods for activation or suppression of PI3K signaling in glial and neuronal progenitors expressing Olig2.
23793848 LGR5 expression may be functionally correlated with the neurogenic competence, and be regulated by OLIG2 in stem-like cells in glioblastoma.
23165259 This study review OLIG2 have developmental functions in patterning, neuron subtype specification and the formation of oligodendrocytes and play the role in the postnatal brain during repair processes and in neurological disease states.
23041832 Report role of OLIG2 immunostaining pattern in diagnosing rare and glioblastoma variants.
More...

AA Sequence

MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKL      1 - 70
GGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHG     71 - 140
PSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPAATAHPAAAAH    141 - 210
AAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSG    211 - 280
ASGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGSLPRLTSDAK                               281 - 323
//

Text Mined References (55)

PMID Year Title
26287936 2016 SOX10 and Olig2 as negative markers for the diagnosis of ependymomas: An immunohistochemical study of 98 glial tumors.
26271930 2015 ASSOCIATION STUDY BETWEEN OLIGODENDROCYTE TRANSCRIPTION FACTOR 2 GENE AND OBSESSIVE-COMPULSIVE DISORDER IN A CHINESE HAN POPULATION.
25966902 2014 Human Dental Pulp Stem Cells Differentiate into Oligodendrocyte Progenitors Using the Expression of Olig2 Transcription Factor.
25384509 2015 Identification of OLIG2 as the most specific glioblastoma stem cell marker starting from comparative analysis of data from similar DNA chip microarray platforms.
25085214 2014 Olig2 labeling index is correlated with histological and molecular classifications in low-grade diffuse gliomas.
24821492 2014 Ceramide galactosyltransferase expression is regulated positively by Nkx2.2 and negatively by OLIG2.
24395742 2014 Pten loss in Olig2 expressing neural progenitor cells and oligodendrocytes leads to interneuron dysplasia and leukodystrophy.
23793848 2013 LGR5 is a proneural factor and is regulated by OLIG2 in glioma stem-like cells.
23568457 2013 Genetic variants associated with disordered eating.
23165259 2012 Separated at birth? The functional and molecular divergence of OLIG1 and OLIG2.
More...