Property Summary

NCBI Gene PubMed Count 63
Grant Count 112
R01 Count 40
Funding $27,375,791.13
PubMed Score 714.82
PubTator Score 79.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
osteosarcoma 2.399 0.000
posterior fossa group B ependymoma 1.900 0.000
astrocytoma 1.400 0.025
glioblastoma 1.100 0.011
Atopic dermatitis -1.200 0.002
non-small cell lung cancer -1.123 0.000
lung cancer -1.900 0.000
pilocytic astrocytoma 1.200 0.000
non primary Sjogren syndrome sicca 1.200 0.029
subependymal giant cell astrocytoma 1.959 0.016
ovarian cancer -2.200 0.000
dermatomyositis 1.100 0.000

Synonym

Accession Q13510 E9PDS0 Q6W898 Q96AS2 AC
Symbols AC
PHP
ASAH
PHP32
ACDase
SMAPME

Gene

Gene RIF (39)

PMID Text
26687835 Genetic or pharmacological acid ceramidase inhibition promotes cisplatin cytotoxicity in head and neck tumor cells.
26553872 AC-controlled sphingolipid metabolism may play an important role in the control of melanoma proliferation
25888580 Data suggest up-regulation of ASAH1 activity by androgen in androgen-sensitive prostate cancer cells (not other cancer cells) is due to prolonged stability of ASAH1 by androgen-stimulated induction of USP2 (ubiquitin specific peptidase 2) expression.
25131496 high ASAH1 expression is generally associated with an improved prognosis in invasive breast cancer independent of adjuvant treatment and could also be valuable as prognostic factor for pre-invasive DCIS.
24355074 novel ASAH1 mutations affecting polypyrimidine tract deletion, and exon skipping and resulting in Farber lipogranulomatosis
24098536 Acid ceramidase promotes nuclear export of PTEN through sphingosine 1-phosphate mediated Akt signaling.
24091326 Immunohistochemical analysis of human prostate cancer tissues revealed higher levels of ASAH1 after radiotherapy failure.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of N-acylsphingosine amidohydrolase 1 (ASAH1, acid ceramidase) expression by HIV-1 Vpr in Vpr transduced macrophages
23777806 Depletion of both Akt2 and ASAH1 is much more potent than depleting each alone at inhibiting neoplastic cell viability/proliferation and invasion.
23707712 This work unravels for the first time the mutations underlying the neonatal form of Farber disease and represents the first report of a large deletion identified in the ASAH1 gene.
More...

AA Sequence

MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKA      1 - 70
PVLKVIVNSLKNMINTFVPSGKIMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTDIPLGEIISFNIFYELF     71 - 140
TICTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFKASSFAGYVGM    141 - 210
LTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDVMWIGFLTRTVLENSTSYEEAKNLLTKTKILAPAY    211 - 280
FILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENIS    281 - 350
FETMYDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW                             351 - 395
//

Text Mined References (73)

PMID Year Title
26687835 2016 Targeting acid ceramidase sensitises head and neck cancer to cisplatin.
26553872 2016 Acid Ceramidase in Melanoma: EXPRESSION, LOCALIZATION, AND EFFECTS OF PHARMACOLOGICAL INHIBITION.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25888580 2015 Increased acid ceramidase expression depends on upregulation of androgen-dependent deubiquitinases, USP2, in a human prostate cancer cell line, LNCaP.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
25131496 2015 Acid ceramidase is associated with an improved prognosis in both DCIS and invasive breast cancer.
24355074 2014 Molecular analyses of novel ASAH1 mutations causing Farber lipogranulomatosis: analyses of exonic splicing enhancer inactivating mutation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24164096 2014 Evidence for clinical, genetic and biochemical variability in spinal muscular atrophy with progressive myoclonic epilepsy.
24098536 2013 Acid ceramidase promotes nuclear export of PTEN through sphingosine 1-phosphate mediated Akt signaling.
More...