Property Summary

Ligand Count 18
NCBI Gene PubMed Count 130
PubMed Score 87.89
PubTator Score 421.45

Knowledge Summary


No data available


  Disease (7)

Disease Target Count P-value
psoriasis 6694 2.3e-20
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Skin cancer 469 0.0 2.6


  Differential Expression (1)

Disease log2 FC p
psoriasis 1.400 2.3e-20

Protein-protein Interaction (12)

Gene RIF (119)

AA Sequence

EYQQYQDATAEEEGEMYEDDEEESEAQGPK                                            421 - 450

Text Mined References (134)

PMID Year Title