Property Summary

NCBI Gene PubMed Count 119
PubMed Score 78.83
PubTator Score 421.45

Knowledge Summary


No data available


  Disease Sources (7)

Disease Target Count
Mammary Neoplasms 410
ovarian neoplasm 97
Disease Target Count P-value
psoriasis 6685 2.29865499871283E-20
Disease Target Count Z-score Confidence
Skin cancer 37 0.0 2.0


  Differential Expression (1)

Disease log2 FC p
psoriasis 1.400 0.000


Accession Q13509 A8K854 Q9BTZ0 Q9BW10
Symbols CDCBM



5IJ0   5IJ9   5JCO  

Gene RIF (107)

27129203 Epitaxial growth of alpha1A/betaIII microtubules from heterogeneous brain seeds is inefficient but can be fully rescued by incorporating as little as 5% of brain tubulin into the homogeneous alpha1A/betaIII lattice.
27046833 mutations proximal to the TUBB3 kinesin-binding site alter polymerization dynamics.
26657157 Functional characterization of MC1R-TUBB3 intergenic splice variants of the human melanocortin 1 receptor has been undertaken in response to ultraviolet irradiation.
26639658 TUBB3 mutations cause both Congenital Fibrosis of the Extraocular Muscles type 3 and malformations of cortical development.
26591579 blocking of the beta-III tubulin expression in colorectal cancer cells does not affect their viability, but reduces the cell adhesion to the extracellular matrix
26426765 The decreased expression of TUBB3 could be a significant marker for predicting unfavourable prognosis in patients with cutaneous malignant melanoma.
26416565 Depletion of betaIII-tubulin from MCF7 breast cancer cells increased mitotic arrest by ixabepilon. Increased betaIII-tubulin may be an important contributor to the development of resistance to ixabepilone.
26406408 High TUBB3 mRNA expression was associated with breast cancer.
26252353 TUBB3, TOP2A, CYP19A1 and CYP2D6 gene expression, but not protein expression, was associated with patient survival in breast cancer .
26198101 Findings suggest that overexpression of Class III beta-tubulin, Sox2, and nuclear Survivin might be predictive of taxane resistance and poor progression-free survival in patients with stage III ovarian epithelial cancer.

AA Sequence

EYQQYQDATAEEEGEMYEDDEEESEAQGPK                                            421 - 450

Text Mined References (123)

PMID Year Title
27129203 2016 Structure and Dynamics of Single-isoform Recombinant Neuronal Human Tubulin.
27046833 2016 Mutations in Human Tubulin Proximal to the Kinesin-Binding Site Alter Dynamic Instability at Microtubule Plus- and Minus-Ends.
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
26657157 2015 Functional Characterization of MC1R-TUBB3 Intergenic Splice Variants of the Human Melanocortin 1 Receptor.
26639658 2016 Two unique TUBB3 mutations cause both CFEOM3 and malformations of cortical development.
26426765 2016 Decreased expression of class III ?-tubulin is associated with unfavourable prognosis in patients with malignant melanoma.
26416565 2015 Mechanism of action of ixabepilone and its interactions with the ?III-tubulin isotype.
26406408 2015 Clinicopathological significance of ? -tubulin isotype III gene expression in breast cancer patients.
26252353 2015 RRM1, TUBB3, TOP2A, CYP19A1, CYP2D6: Difference between mRNA and protein expression in predicting prognosis of breast cancer patients.