Property Summary

NCBI Gene PubMed Count 18
PubMed Score 22.60
PubTator Score 39.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 3.029 3.5e-03
active ulcerative colitis 1.790 9.9e-03
adult high grade glioma -1.200 1.6e-02
astrocytic glioma -2.400 7.9e-03
atypical teratoid / rhabdoid tumor -2.200 7.9e-08
Becker muscular dystrophy -1.150 5.7e-04
Duchenne muscular dystrophy -1.513 9.4e-08
ependymoma -2.100 4.9e-02
facioscapulohumeral dystrophy 1.800 4.7e-02
glioblastoma -1.600 1.6e-04
group 4 medulloblastoma -1.800 5.0e-04
limb girdle muscular dystrophy 2A -1.277 2.2e-05
oligodendroglioma -2.000 2.0e-02
Pick disease -1.100 8.3e-04
pituitary cancer -1.300 1.1e-02
primitive neuroectodermal tumor -1.600 2.4e-02
subependymal giant cell astrocytoma -1.006 4.6e-02

Gene RIF (8)

AA Sequence

MKTGHFEIVTMLLATMILVDIFQVKAEVLDMADNAFDDEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVW      1 - 70
ENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAFHF     71 - 140
YLTRALQLLRKPCEASSKTVVYRTSQGTSFTFGGLNQARFGHFTLAYSAKPQAANDQLTVLSIYTCLGVD    141 - 210
IENFLDKESERITLIPLNEVFQVSQEGAGNNLILQSINKTCSHYECAFLGGLKTENCIENLEYFQPIYVY    211 - 280
NPGEKNQKLEDHSEKNWKLEDHGEKNQKLEDHGVKILEPTQIPGMKIPEPFPLPEDKSQGNINNPTPGPV    281 - 350
PVPGPKSHPSASSGKLLLPQFGMVIILISVSAINLFVAL                                   351 - 389
//

Text Mined References (20)

PMID Year Title