Tbio | Ecto-ADP-ribosyltransferase 3 |
This gene encodes an arginine-specific ADP-ribosyltransferase. The encoded protein catalyzes a reversible reaction which modifies proteins by the addition or removal of ADP-ribose to an arginine residue to regulate the function of the modified protein. An ADP-ribosyltransferase pseudogene is located on chromosome 11. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]
Comments
Disease | Target Count | P-value |
---|---|---|
medulloblastoma | 1524 | 5.74178176596177E-9 |
atypical teratoid / rhabdoid tumor | 4369 | 7.88499104072285E-8 |
Duchenne muscular dystrophy | 602 | 9.39558740166905E-8 |
limb girdle muscular dystrophy 2A | 156 | 2.20453545241556E-5 |
glioblastoma | 5572 | 1.63358279667395E-4 |
Becker muscular dystrophy | 187 | 5.72460302306849E-4 |
pediatric high grade glioma | 2712 | 8.00040610636032E-4 |
Pick disease | 1893 | 8.31601732634764E-4 |
active Crohn's disease | 918 | 0.00345032641935056 |
astrocytic glioma | 2241 | 0.00791496220265058 |
active ulcerative colitis | 477 | 0.00989368431123447 |
pituitary cancer | 1972 | 0.0112417695300576 |
oligodendroglioma | 2849 | 0.0202950291035543 |
primitive neuroectodermal tumor | 3031 | 0.0242814824938801 |
subependymal giant cell astrocytoma | 2287 | 0.0456349526898319 |
facioscapulohumeral dystrophy | 286 | 0.0472758662712687 |
ependymoma | 2514 | 0.0485252651986283 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Esophageal candidiasis | 3 | 3.755 | 1.9 |
Azoospermia | 89 | 3.551 | 1.8 |
Disease | log2 FC | p |
---|---|---|
astrocytic glioma | -2.400 | 0.008 |
ependymoma | -2.100 | 0.049 |
oligodendroglioma | -2.000 | 0.020 |
medulloblastoma | -2.300 | 0.000 |
atypical teratoid / rhabdoid tumor | -2.200 | 0.000 |
glioblastoma | -1.600 | 0.000 |
primitive neuroectodermal tumor | -1.600 | 0.024 |
Duchenne muscular dystrophy | -1.513 | 0.000 |
Becker muscular dystrophy | -1.150 | 0.001 |
limb girdle muscular dystrophy 2A | -1.277 | 0.000 |
active Crohn's disease | 3.029 | 0.003 |
active ulcerative colitis | 1.790 | 0.010 |
pediatric high grade glioma | -1.300 | 0.001 |
subependymal giant cell astrocytoma | -1.006 | 0.046 |
Pick disease | -1.100 | 0.001 |
pituitary cancer | -1.300 | 0.011 |
facioscapulohumeral dystrophy | 1.800 | 0.047 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
20628086 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) |
20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) |
20237496 | Observational study of gene-disease association. (HuGE Navigator) |
19913121 | Observational study of gene-disease association. (HuGE Navigator) |
18266473 | genome-wide gene expression analyses were used to identify genes involved in the pathogenesis of non-obstructive azoospermia, and ART3 was subsequently identified as a susceptibility gene |
18266473 | Observational study of gene-disease association. (HuGE Navigator) |
16934346 | ART3 expression appears to be governed by a combination of differential splicing and tissue-preferential use of two alternative promoters. |
16625277 | ART3 protein is expressed in testes in particular on spermatocytes, indicating that ART3 exerts a specific function only required at a particular stage of spermatogenesis. |
MKTGHFEIVTMLLATMILVDIFQVKAEVLDMADNAFDDEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVW 1 - 70 ENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAFHF 71 - 140 YLTRALQLLRKPCEASSKTVVYRTSQGTSFTFGGLNQARFGHFTLAYSAKPQAANDQLTVLSIYTCLGVD 141 - 210 IENFLDKESERITLIPLNEVFQVSQEGAGNNLILQSINKTCSHYECAFLGGLKTENCIENLEYFQPIYVY 211 - 280 NPGEKNQKLEDHSEKNWKLEDHGEKNQKLEDHGVKILEPTQIPGMKIPEPFPLPEDKSQGNINNPTPGPV 281 - 350 PVPGPKSHPSASSGKLLLPQFGMVIILISVSAINLFVAL 351 - 389 //
PMID | Year | Title |
---|---|---|
23533145 | 2013 | In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine. |
22171320 | 2012 | Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD. |
20628086 | 2010 | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. |
20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | |
20237496 | 2010 | New genetic associations detected in a host response study to hepatitis B vaccine. |
20106667 | 2010 | Toward a unified nomenclature for mammalian ADP-ribosyltransferases. |
19913121 | 2009 | Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip. |
18266473 | 2008 | Genome-wide expression of azoospermia testes demonstrates a specific profile and implicates ART3 in genetic susceptibility. |
18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. |
16934346 | 2006 | Genomic organization and expression of the human mono-ADP-ribosyltransferase ART3 gene. |
More... |