| Tbio | Ecto-ADP-ribosyltransferase 3 |
This gene encodes an arginine-specific ADP-ribosyltransferase. The encoded protein catalyzes a reversible reaction which modifies proteins by the addition or removal of ADP-ribose to an arginine residue to regulate the function of the modified protein. An ADP-ribosyltransferase pseudogene is located on chromosome 11. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]
Comments
Property Summary
| NCBI Gene PubMed Count | 18 |
| Grant Count | 4 |
| Funding | $440,942.01 |
| PubMed Score | 20.51 |
| PubTator Score | 39.50 |
| Disease | log2 FC | p |
|---|---|---|
| astrocytic glioma | -2.400 | 0.008 |
| ependymoma | -2.100 | 0.049 |
| oligodendroglioma | -2.000 | 0.020 |
| medulloblastoma | -2.300 | 0.000 |
| atypical teratoid / rhabdoid tumor | -2.200 | 0.000 |
| glioblastoma | -1.600 | 0.000 |
| primitive neuroectodermal tumor | -1.600 | 0.024 |
| Duchenne muscular dystrophy | -1.513 | 0.000 |
| Becker muscular dystrophy | -1.150 | 0.001 |
| limb girdle muscular dystrophy 2A | -1.277 | 0.000 |
| active Crohn's disease | 3.029 | 0.003 |
| active ulcerative colitis | 1.790 | 0.010 |
| pediatric high grade glioma | -1.300 | 0.001 |
| subependymal giant cell astrocytoma | -1.006 | 0.046 |
| Pick disease | -1.100 | 0.001 |
| pituitary cancer | -1.300 | 0.011 |
| facioscapulohumeral dystrophy | 1.800 | 0.047 |
| PMID | Text |
|---|---|
| 20628086 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) |
| 20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) |
| 20237496 | Observational study of gene-disease association. (HuGE Navigator) |
| 19913121 | Observational study of gene-disease association. (HuGE Navigator) |
| 18266473 | genome-wide gene expression analyses were used to identify genes involved in the pathogenesis of non-obstructive azoospermia, and ART3 was subsequently identified as a susceptibility gene |
| 18266473 | Observational study of gene-disease association. (HuGE Navigator) |
| 16934346 | ART3 expression appears to be governed by a combination of differential splicing and tissue-preferential use of two alternative promoters. |
| 16625277 | ART3 protein is expressed in testes in particular on spermatocytes, indicating that ART3 exerts a specific function only required at a particular stage of spermatogenesis. |
MKTGHFEIVTMLLATMILVDIFQVKAEVLDMADNAFDDEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVW 1 - 70 ENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAFHF 71 - 140 YLTRALQLLRKPCEASSKTVVYRTSQGTSFTFGGLNQARFGHFTLAYSAKPQAANDQLTVLSIYTCLGVD 141 - 210 IENFLDKESERITLIPLNEVFQVSQEGAGNNLILQSINKTCSHYECAFLGGLKTENCIENLEYFQPIYVY 211 - 280 NPGEKNQKLEDHSEKNWKLEDHGEKNQKLEDHGVKILEPTQIPGMKIPEPFPLPEDKSQGNINNPTPGPV 281 - 350 PVPGPKSHPSASSGKLLLPQFGMVIILISVSAINLFVAL 351 - 389 //
| PMID | Year | Title |
|---|---|---|
| 23533145 | 2013 | In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine. |
| 22171320 | 2012 | Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD. |
| 20628086 | 2010 | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. |
| 20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | |
| 20237496 | 2010 | New genetic associations detected in a host response study to hepatitis B vaccine. |
| 20106667 | 2010 | Toward a unified nomenclature for mammalian ADP-ribosyltransferases. |
| 19913121 | 2009 | Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip. |
| 18266473 | 2008 | Genome-wide expression of azoospermia testes demonstrates a specific profile and implicates ART3 in genetic susceptibility. |
| 18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. |
| 16934346 | 2006 | Genomic organization and expression of the human mono-ADP-ribosyltransferase ART3 gene. |
| More... |
