Property Summary

NCBI Gene PubMed Count 18
Grant Count 4
Funding $440,942.01
PubMed Score 20.51
PubTator Score 39.50

Knowledge Summary


No data available


  Differential Expression (17)


Accession Q13508 Q53XW3 Q6FHT7 Q8WVJ7 Q93069 Q96HL1
Symbols ARTC3


PANTHER Protein Class (2)

Gene RIF (8)

20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18266473 genome-wide gene expression analyses were used to identify genes involved in the pathogenesis of non-obstructive azoospermia, and ART3 was subsequently identified as a susceptibility gene
18266473 Observational study of gene-disease association. (HuGE Navigator)
16934346 ART3 expression appears to be governed by a combination of differential splicing and tissue-preferential use of two alternative promoters.
16625277 ART3 protein is expressed in testes in particular on spermatocytes, indicating that ART3 exerts a specific function only required at a particular stage of spermatogenesis.

AA Sequence

PVPGPKSHPSASSGKLLLPQFGMVIILISVSAINLFVAL                                   351 - 389

Publication (20)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18266473 2008 Genome-wide expression of azoospermia testes demonstrates a specific profile and implicates ART3 in genetic susceptibility.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16934346 2006 Genomic organization and expression of the human mono-ADP-ribosyltransferase ART3 gene.